Os12t0508500-01

Locus

Os12g0508500

Description

bHLH transcription factor, Regulation of iron distribution

RAP-DB Gene Symbol Synonym(s)

OsbHLH133

RAP-DB Gene Name Synonym(s)

basic helix-loop-helix protein 133

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsbHLH133, bHLH133, OsRSL8, RSL8

Oryzabase Gene Name Synonym(s)

basic helix-loop-helix protein 133, ROOT HAIR DEFECTIVE-SIX LIKE 8

Transcript Evidence

Q2QQ32 (UniProt)

Protein Evidence

Q2QQ32

Literature

PMID: 22755510

Note

Manual Curation

August 5, 2020

Gene Ontology (GO)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

Helix-loop-helix DNA-binding domain superfamily (IPR036638)

Myc-type, basic helix-loop-helix (bHLH) domain (IPR011598)

Expression Databases

TENOR (Os12t0508500-00)

Others

Oryzabase (11128)

Transcript

597 bp

>Os12t0508500-01 bHLH transcription factor, Regulation of iron distribution
ATGGAATGCAGCTCCTTTGAAGCAATCTGCAATGAGTCGGAGATGATTGCGCATTTGCAG
TCATTGTTCTGGAGCAGCAGCGATGCTGATCCTTGTTTTGGTAGCTCATCATTTTCTCTC
ATCAGTAGTGAGGGCTACGACACAATGACCACAGAGTTTGTGAATAGCAGCACAAATGTA
TGTTTTGATTACCAAGATGATAGCTTCGTTTCAGCAGAGGAGACTACCATTGGTAACAAG
AGAAAAGTTCAGATGGATACTGAGAATGAGCTGATGACGAACCGCAGCAAGGAAGTTCGC
ACCAAGATGTCGGTGTCAAAAGCATGCAAACATTCTGTTTCTGCAGAGAGCTCACAGTCT
TATTATGCAAAGAACAGGAGACAGAGGATCAATGAGAGATTGAGAATACTGCAAGAACTG
ATCCCTAATGGAACAAAAGTTGACATCAGCACAATGTTGGAGGAAGCAATTCAGTATGTC
AAGTTTCTACACCTGCAAATCAAGCTCTTGAGCTCTGATGAAATGTGGATGTATGCGCCC
CTTGCTTTTGACAGTGGTAACAACAGGCTCTATCAGAACTCTCTGTCACAAGAGTAG

CDS

597 bp

>Os12t0508500-01 bHLH transcription factor, Regulation of iron distribution
ATGGAATGCAGCTCCTTTGAAGCAATCTGCAATGAGTCGGAGATGATTGCGCATTTGCAG
TCATTGTTCTGGAGCAGCAGCGATGCTGATCCTTGTTTTGGTAGCTCATCATTTTCTCTC
ATCAGTAGTGAGGGCTACGACACAATGACCACAGAGTTTGTGAATAGCAGCACAAATGTA
TGTTTTGATTACCAAGATGATAGCTTCGTTTCAGCAGAGGAGACTACCATTGGTAACAAG
AGAAAAGTTCAGATGGATACTGAGAATGAGCTGATGACGAACCGCAGCAAGGAAGTTCGC
ACCAAGATGTCGGTGTCAAAAGCATGCAAACATTCTGTTTCTGCAGAGAGCTCACAGTCT
TATTATGCAAAGAACAGGAGACAGAGGATCAATGAGAGATTGAGAATACTGCAAGAACTG
ATCCCTAATGGAACAAAAGTTGACATCAGCACAATGTTGGAGGAAGCAATTCAGTATGTC
AAGTTTCTACACCTGCAAATCAAGCTCTTGAGCTCTGATGAAATGTGGATGTATGCGCCC
CTTGCTTTTGACAGTGGTAACAACAGGCTCTATCAGAACTCTCTGTCACAAGAGTAG

Protein

199 aa

>Os12t0508500-01 bHLH transcription factor, Regulation of iron distribution
MECSSFEAICNESEMIAHLQSLFWSSSDADPCFGSSSFSLISSEGYDTMTTEFVNSSTNV
CFDYQDDSFVSAEETTIGNKRKVQMDTENELMTNRSKEVRTKMSVSKACKHSVSAESSQS
YYAKNRRQRINERLRILQELIPNGTKVDISTMLEEAIQYVKFLHLQIKLLSSDEMWMYAP
LAFDSGNNRLYQNSLSQE*

CDS

chr12:19546556..19546867 (+ strand) : 312 bp

chr12:19546958..19547017 (+ strand) : 60 bp

chr12:19547095..19547160 (+ strand) : 66 bp

chr12:19547236..19547301 (+ strand) : 66 bp

chr12:19547472..19547564 (+ strand) : 93 bp

FASTA

>Os12t0508500-01 class=Sequence position=chr12:19546556..19547564 (+ strand)
ATGGAATGCA GCTCCTTTGA AGCAATCTGC AATGAGTCGG AGATGATTGC GCATTTGCAG TCATTGTTCT GGAGCAGCAG
CGATGCTGAT CCTTGTTTTG GTAGCTCATC ATTTTCTCTC ATCAGTAGTG AGGGCTACGA CACAATGACC ACAGAGTTTG
TGAATAGCAG CACAAATGTA TGTTTTGATT ACCAAGATGA TAGCTTCGTT TCAGCAGAGG AGACTACCAT TGGTAACAAG
AGAAAAGTTC AGATGGATAC TGAGAATGAG CTGATGACGA ACCGCAGCAA GGAAGTTCGC ACCAAGATGT CGGTAAGGGC
TTACGTTTGA TGGAGTACCA TAGTACTATA TATATTTTTT GTCATGGAAT TTGTTGAACT TCAAGTAAGT TTGGATTTGC
AGGTGTCAAA AGCATGCAAA CATTCTGTTT CTGCAGAGAG CTCACAGTCT TATTATGCAA AGGTTTACTA GTTTGTTAAA
TTGTATTAGG AGCTTTTCAG TCTAGTTTCT GATCTTGCCA CACAATGCTT GTAAAACAGA ACAGGAGACA GAGGATCAAT
GAGAGATTGA GAATACTGCA AGAACTGATC CCTAATGGAA CAAAAGTAAG TTCTTGCTGG TTTGATCAGT GGCTGTAATT
AGCAGTGGTT AAATTGTTCC TTTTTTTTAT ACATTTGCAG GTTGACATCA GCACAATGTT GGAGGAAGCA ATTCAGTATG
TCAAGTTTCT ACACCTGCAA ATCAAGGTGT GCATTCAGTT CTTAGTTATG AGCTGACACA AATAAGACTG GATCTGAGAT
TTCACTACAT TGCATAGTTG CATTGAATAT ATGTGTGTAC TAGTATAACA TTAGAAATAT CCAAGTGTTA CAGTGATCAT
TTTCCTGACC TTTTTTACTT TCTGAATGTT GCACAGCTCT TGAGCTCTGA TGAAATGTGG ATGTATGCGC CCCTTGCTTT
TGACAGTGGT AACAACAGGC TCTATCAGAA CTCTCTGTCA CAAGAGTAG

Locus: Os12g0508500

Loading...

Locus: Os12g0508500

Loading...