Os12t0512700-01

Locus

Os12g0512700

Description

ABC transporter-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PDR23

CGSNL Gene Name

PLEIOTROPIC DRUG RESISTANCE 23

Oryzabase Gene Symbol Synonym(s)

OsABCG50, OsPDR23, OsABCG50_1, OsABCG50_2

Oryzabase Gene Name Synonym(s)

ABC transporter superfamily ABCG subgroup member 50, pleiotropic drug resistance 23

Transcript Evidence

AK103110 (DDBJ, Best hit)

AK102367 (DDBJ, Best hit)

Protein Evidence

B9GDE5-2

Literature

Note

Manual Curation

February 18, 2020

Gene Ontology (GO)

Cellular Component: membrane (GO:0016020)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: ATPase activity (GO:0016887)

Functional domain (InterPro)

ABC transporter-like (IPR003439)

ABC-2 type transporter (IPR013525)

Plant PDR ABC transporter associated (IPR013581)

Full-length cDNA

J033119C07 (Online Clone Ordering)

J033091K10 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0512700-01)

Others

Oryzabase (12023)

Transcript

2681 bp

>Os12t0512700-01 ABC transporter-like domain containing protein.
CAGCGCCGCCGCAATTCGCTCGCCGCCGCCGCCGCcgccggtgggcggtggcttgccacc
tccctctccgcctccggcagccttctacgctgcccgtctccgTCTCTTCTCCCTTCACCC
AAATCCCCAGACATTCGGCCATGGCCCCCCCTGACTCTTCTCTCTTCTTGGCCGCCCGCC
GCGGCGCTGCCTGACGAGGATCGGCGGCTCGGGGCGGAGGAACCCCGAGCTTCCGGCGCG
AGGGGGTGGCCTCCTCCTCCTCCTCATCCTCATCGTCGCCGCCGCCCACGTCGTCTCGCC
CTCGGCCAACGCCCGAGCTCGACCACAAACTAAAAATCAAGAACAAGAAAGTTTTATGTT
CTGACAAACTGAATGTGAAGATGCAAAGCTTTTACAGGTAACAGGGGATATCTCTTACAA
TGGCTATCAGCTTGATGAATTTGTGCCTGAGAAAACAGCCGCGTATATCAGCCAATACGA
TTTACACATTCCTGAGATGACTGTGAGGGAGACTTTGGACTTCTCATCCCGGTGCCAAGG
TGTTGGAAGAAGACCAAAAATACTCAAGGAGGTGAGCGCGAGGGAGAGCGCGGCGGGGAT
CATACCTGATGCGGACATAGATATATACATGAAGGCTATATCAGTTGAAGCTTCAAAGAG
AAGCCTACAGACAGACTATATTTTGAAGATCATGGGGCTAGAGATATGCGCAGACACGAT
GGTTGGGGATGCAATGATAAGAGGACTATCAGGGGGGCAGAAGAAAAGATTAACCACAGC
TGAGATGATTGTGGGGCCTGCAAGAGCATACTTTATGGATGAAATATCAAATGGTCTGGA
TAGCTCTACCACTTTTCAAATAATAAGTTGTTTCCAGCAACTGACGAACATCAGCGAGTA
CACCATGGTTATTTCACTTCTTCAACCAACACCTGAGGTATTTGATCTTTTTGATGACCT
GATATTAATGGCAGAAGGGAAAATTATATACCATGGCCCTCGAAATGAAGCTCTGAATTT
TTTTGAGGAGTGTGGGTTCATATGCCCAGAAAGAAAAGAGGTAGCTGACTTTCTCCAAGA
GATCTTGTCCTGCAAGGACCAACAACAGTACTGGTCTGGTCCAAATGAATCTTACAGATA
TATATCACCCCATGAATTATCAAGCATGTTCAAGGAAAATCACAGAGGGAGAAAACTAGA
AGAACCAATTGTTTCTCCGAAAAGCGAGTTGGGCAAGGAAGCTTTAGCATTCAATAAATA
TTCTCTGCAAAAACTGGAAATGTTCAAAGCCTGTGGAGCAAGGGAAGCACTCCTAATGAA
AAGGAGTATGTTTGTTTATGTCTTCAAAACAGGCCAGCTTGCCATTATTGCACTCGTAAC
AATGTCTGTGTTCCTTCGAACTCGCATGACAACAGATTTCACTCACGCAACTTACTATAT
GGGAGCATTGTTTTTTTCCATCTTAATGATCATGCTAAATGGCACACCAGAGATAAGCAT
GCAGATTAGGAGACTCCCAAGTTTTTACAAGCAAAAGAGCTATTATTTCTATTCTTCATG
GGCATATGCAATACCAGCTTCAGTCCTAAAGGTCCCTGTTTCCATATTAGATTCACTTGT
ATGGATATGTATCACATATTACGGTATTGGTTATACAGCTAGTGTTTCGAGGTTCTTCTG
CCAATTTCTGATGCTTTGTTTTGTCCATCAATCAGTCACTTCGCTGTATCGATTTATTGC
TTCATACTTCCAAACACCTACTGCGTCTTTCTTCTACCTTTTTCTGGCTCTAACATTCTT
CCTCATGTTTGGAGGCTTCACTCTTCCCAAGCCCTCCATGCCAGGATGGTTAAACTGGGG
ATTTTGGATTTCTCCAATGACATATGCAGAAATCGGCACAGTTATTAATGAATTCCAAGC
GCCAAGATGGCAGAAGGAAACTATTCAAAACATAACAATTGGGAACCGAATCCTGATTAA
TCATGGCCTATATTACAGTTGGCACTTTTATTGGATATCCATTGGAGCATTGTTCGGATC
AATCATTTTATTTTATATCGCTTTTGGATTGGCGCTAGATTATATTACATCTATAGAAGA
ATATCATGGAAGTAGGCCTATAAAGAGGTTATGTCAAGAACAGGAAAAAGATTCTAATAT
ACGAAAAGAATCTGATGGTCATTCAAATATTTCCAGAGCAAAGATGACTATACCTGTTAT
GGAACTTCCAATTACGTTCCACAATCTGAACTACTACATTGATACCCCACCGGAAATGCT
GAAACAAGGCTATCCAACAAAAAGACTTCAACTACTTAACAACATAACTGGTGCATTGCG
TCCCGGTGTTCTTTCTGCACTAATGGGTGTCAGTGGAGCCGGGAAGACAACTCTGCTAGA
TGTATTAGCAGGAAGGAAAACAGGAGGATATATTGAAGGGGACATAAGAATAGGTGGATA
TCCCAAGGTGCAAGAAACATTTGTTAGAATCTTAGGTTACTGTGAGCAAGCCGACATACA
TTCCCCACAGCTCACAGTTGAAGAGTCTGTAACTTATTCTGCTTGGCTTCGTCTACCTTC
TCATGTCGACAAAAAAACAAGATCTGTATGTCCCTTGGAAGTTGGAACAACACAGACATA
TACTGATTTTAATAACAGATAGATAAACAAGAAGCTTACCT

CDS

2166 bp

>Os12t0512700-01 ABC transporter-like domain containing protein.
ATGACTGTGAGGGAGACTTTGGACTTCTCATCCCGGTGCCAAGGTGTTGGAAGAAGACCA
AAAATACTCAAGGAGGTGAGCGCGAGGGAGAGCGCGGCGGGGATCATACCTGATGCGGAC
ATAGATATATACATGAAGGCTATATCAGTTGAAGCTTCAAAGAGAAGCCTACAGACAGAC
TATATTTTGAAGATCATGGGGCTAGAGATATGCGCAGACACGATGGTTGGGGATGCAATG
ATAAGAGGACTATCAGGGGGGCAGAAGAAAAGATTAACCACAGCTGAGATGATTGTGGGG
CCTGCAAGAGCATACTTTATGGATGAAATATCAAATGGTCTGGATAGCTCTACCACTTTT
CAAATAATAAGTTGTTTCCAGCAACTGACGAACATCAGCGAGTACACCATGGTTATTTCA
CTTCTTCAACCAACACCTGAGGTATTTGATCTTTTTGATGACCTGATATTAATGGCAGAA
GGGAAAATTATATACCATGGCCCTCGAAATGAAGCTCTGAATTTTTTTGAGGAGTGTGGG
TTCATATGCCCAGAAAGAAAAGAGGTAGCTGACTTTCTCCAAGAGATCTTGTCCTGCAAG
GACCAACAACAGTACTGGTCTGGTCCAAATGAATCTTACAGATATATATCACCCCATGAA
TTATCAAGCATGTTCAAGGAAAATCACAGAGGGAGAAAACTAGAAGAACCAATTGTTTCT
CCGAAAAGCGAGTTGGGCAAGGAAGCTTTAGCATTCAATAAATATTCTCTGCAAAAACTG
GAAATGTTCAAAGCCTGTGGAGCAAGGGAAGCACTCCTAATGAAAAGGAGTATGTTTGTT
TATGTCTTCAAAACAGGCCAGCTTGCCATTATTGCACTCGTAACAATGTCTGTGTTCCTT
CGAACTCGCATGACAACAGATTTCACTCACGCAACTTACTATATGGGAGCATTGTTTTTT
TCCATCTTAATGATCATGCTAAATGGCACACCAGAGATAAGCATGCAGATTAGGAGACTC
CCAAGTTTTTACAAGCAAAAGAGCTATTATTTCTATTCTTCATGGGCATATGCAATACCA
GCTTCAGTCCTAAAGGTCCCTGTTTCCATATTAGATTCACTTGTATGGATATGTATCACA
TATTACGGTATTGGTTATACAGCTAGTGTTTCGAGGTTCTTCTGCCAATTTCTGATGCTT
TGTTTTGTCCATCAATCAGTCACTTCGCTGTATCGATTTATTGCTTCATACTTCCAAACA
CCTACTGCGTCTTTCTTCTACCTTTTTCTGGCTCTAACATTCTTCCTCATGTTTGGAGGC
TTCACTCTTCCCAAGCCCTCCATGCCAGGATGGTTAAACTGGGGATTTTGGATTTCTCCA
ATGACATATGCAGAAATCGGCACAGTTATTAATGAATTCCAAGCGCCAAGATGGCAGAAG
GAAACTATTCAAAACATAACAATTGGGAACCGAATCCTGATTAATCATGGCCTATATTAC
AGTTGGCACTTTTATTGGATATCCATTGGAGCATTGTTCGGATCAATCATTTTATTTTAT
ATCGCTTTTGGATTGGCGCTAGATTATATTACATCTATAGAAGAATATCATGGAAGTAGG
CCTATAAAGAGGTTATGTCAAGAACAGGAAAAAGATTCTAATATACGAAAAGAATCTGAT
GGTCATTCAAATATTTCCAGAGCAAAGATGACTATACCTGTTATGGAACTTCCAATTACG
TTCCACAATCTGAACTACTACATTGATACCCCACCGGAAATGCTGAAACAAGGCTATCCA
ACAAAAAGACTTCAACTACTTAACAACATAACTGGTGCATTGCGTCCCGGTGTTCTTTCT
GCACTAATGGGTGTCAGTGGAGCCGGGAAGACAACTCTGCTAGATGTATTAGCAGGAAGG
AAAACAGGAGGATATATTGAAGGGGACATAAGAATAGGTGGATATCCCAAGGTGCAAGAA
ACATTTGTTAGAATCTTAGGTTACTGTGAGCAAGCCGACATACATTCCCCACAGCTCACA
GTTGAAGAGTCTGTAACTTATTCTGCTTGGCTTCGTCTACCTTCTCATGTCGACAAAAAA
ACAAGATCTGTATGTCCCTTGGAAGTTGGAACAACACAGACATATACTGATTTTAATAAC
AGATAG

Protein

721 aa

>Os12t0512700-01 ABC transporter-like domain containing protein.
MTVRETLDFSSRCQGVGRRPKILKEVSARESAAGIIPDADIDIYMKAISVEASKRSLQTD
YILKIMGLEICADTMVGDAMIRGLSGGQKKRLTTAEMIVGPARAYFMDEISNGLDSSTTF
QIISCFQQLTNISEYTMVISLLQPTPEVFDLFDDLILMAEGKIIYHGPRNEALNFFEECG
FICPERKEVADFLQEILSCKDQQQYWSGPNESYRYISPHELSSMFKENHRGRKLEEPIVS
PKSELGKEALAFNKYSLQKLEMFKACGAREALLMKRSMFVYVFKTGQLAIIALVTMSVFL
RTRMTTDFTHATYYMGALFFSILMIMLNGTPEISMQIRRLPSFYKQKSYYFYSSWAYAIP
ASVLKVPVSILDSLVWICITYYGIGYTASVSRFFCQFLMLCFVHQSVTSLYRFIASYFQT
PTASFFYLFLALTFFLMFGGFTLPKPSMPGWLNWGFWISPMTYAEIGTVINEFQAPRWQK
ETIQNITIGNRILINHGLYYSWHFYWISIGALFGSIILFYIAFGLALDYITSIEEYHGSR
PIKRLCQEQEKDSNIRKESDGHSNISRAKMTIPVMELPITFHNLNYYIDTPPEMLKQGYP
TKRLQLLNNITGALRPGVLSALMGVSGAGKTTLLDVLAGRKTGGYIEGDIRIGGYPKVQE
TFVRILGYCEQADIHSPQLTVEESVTYSAWLRLPSHVDKKTRSVCPLEVGTTQTYTDFNN
R*

5'UTR

chr12:19836568..19837063 (- strand) : 496 bp

CDS

chr12:19836507..19836567 (- strand) : 61 bp

chr12:19836327..19836403 (- strand) : 77 bp

chr12:19836047..19836100 (- strand) : 54 bp

chr12:19835873..19835963 (- strand) : 91 bp

chr12:19835466..19835767 (- strand) : 302 bp

chr12:19835089..19835364 (- strand) : 276 bp

chr12:19834697..19835010 (- strand) : 314 bp

chr12:19834444..19834604 (- strand) : 161 bp

chr12:19834267..19834370 (- strand) : 104 bp

chr12:19834025..19834178 (- strand) : 154 bp

chr12:19833457..19833564 (- strand) : 108 bp

chr12:19833247..19833320 (- strand) : 74 bp

chr12:19832753..19833142 (- strand) : 390 bp

3'UTR

chr12:19832734..19832752 (- strand) : 19 bp

FASTA

>Os12t0512700-01 class=Sequence position=chr12:19832734..19837063 (- strand)
CAGCGCCGCC GCAATTCGCT CGCCGCCGCC GCCGCcgccg gtgggcggtg gcttgccacc tccctctccg cctccggcag
ccttctacgc tgcccgtctc cgTCTCTTCT CCCTTCACCC AAATCCCCAG ACATTCGGCC ATGGCCCCCC CTGACTCTTC
TCTCTTCTTG GCCGCCCGCC GCGGCGCTGC CTGACGAGGA TCGGCGGCTC GGGGCGGAGG AACCCCGAGC TTCCGGCGCG
AGGGGGTGGC CTCCTCCTCC TCCTCATCCT CATCGTCGCC GCCGCCCACG TCGTCTCGCC CTCGGCCAAC GCCCGAGCTC
GACCACAAAC TAAAAATCAA GAACAAGAAA GTTTTATGTT CTGACAAACT GAATGTGAAG ATGCAAAGCT TTTACAGGTA
ACAGGGGATA TCTCTTACAA TGGCTATCAG CTTGATGAAT TTGTGCCTGA GAAAACAGCC GCGTATATCA GCCAATACGA
TTTACACATT CCTGAGATGA CTGTGAGGGA GACTTTGGAC TTCTCATCCC GGTGCCAAGG TGTTGGAAGA AGACCAAGTA
AGTGTAATGG ACATTCTTCA CCAAAATTCT TGATCAGAAA AAGAAAAAGT TCTTGATTAA TTGCAATAAT TTCTTACTCA
CTGATTTTGT TTGCTCAAAG AAATACTCAA GGAGGTGAGC GCGAGGGAGA GCGCGGCGGG GATCATACCT GATGCGGACA
TAGATATATA CATGAAGGTA AAAGATGTGT TATCCTTTTA TGCACTGGCT GGCATTATTC TTCCTCACTT CACAAAAAAA
AGCAACACCT GATTATTTGA GGTAATACTA ACAATGTAAC CTTTCTTGCT AGAATAATAT TGGGTTGTAG TAAAACTAAG
GCAAAGCTTT CAGTAATCAA CATTTCTATT TCTATTTCTA TAATTAAACA TTTTGGTTTT CAAAAGCAAA GTGGCTACTG
CAGGCTATAT CAGTTGAAGC TTCAAAGAGA AGCCTACAGA CAGACTATAT TTTGAAGGTA CATTTCCCCA AAACATACAA
GTTTAACTTT CAGATAGTGA AAATATACCA ACAAGAATCA CAGTGCCGCT TGAATTGTAG ATCATGGGGC TAGAGATATG
CGCAGACACG ATGGTTGGGG ATGCAATGAT AAGAGGACTA TCAGGGGGGC AGAAGAAAAG ATTAACCACA GGTATGGTAA
AGCTGATCGA TATTACTTGG AAATACATTC TTCCAAATTA AGGCGATCGA TCGATTACCT TGTGTATAAT CTTAAACTTT
CACCTTCTTG CACCAGCTGA GATGATTGTG GGGCCTGCAA GAGCATACTT TATGGATGAA ATATCAAATG GTCTGGATAG
CTCTACCACT TTTCAAATAA TAAGTTGTTT CCAGCAACTG ACGAACATCA GCGAGTACAC CATGGTTATT TCACTTCTTC
AACCAACACC TGAGGTATTT GATCTTTTTG ATGACCTGAT ATTAATGGCA GAAGGGAAAA TTATATACCA TGGCCCTCGA
AATGAAGCTC TGAATTTTTT TGAGGAGTGT GGGTTCATAT GCCCAGAAAG AAAAGAGGTA GCTGACTTTC TCCAAGAGGT
AATTTTCCTC AATCACAAGA GCAGCTGCAG CACCTGATTT ATATATAAAT TGCATGTTCA TGAAAACAGT TCTTTTTTTT
CTGATTCCGA AACCATTAGA TCTTGTCCTG CAAGGACCAA CAACAGTACT GGTCTGGTCC AAATGAATCT TACAGATATA
TATCACCCCA TGAATTATCA AGCATGTTCA AGGAAAATCA CAGAGGGAGA AAACTAGAAG AACCAATTGT TTCTCCGAAA
AGCGAGTTGG GCAAGGAAGC TTTAGCATTC AATAAATATT CTCTGCAAAA ACTGGAAATG TTCAAAGCCT GTGGAGCAAG
GGAAGCACTC CTAATGAAAA GGAGTATGTT TGTTTATGTC TTCAAAACAG GCCAGGTTAT ACTTCATTCT AAGGCCCTCT
TTCCTGTACG AAGTAAATTT TGAGTCCTAA CTGAGGTTTA CTCCTTACTG CAGCTTGCCA TTATTGCACT CGTAACAATG
TCTGTGTTCC TTCGAACTCG CATGACAACA GATTTCACTC ACGCAACTTA CTATATGGGA GCATTGTTTT TTTCCATCTT
AATGATCATG CTAAATGGCA CACCAGAGAT AAGCATGCAG ATTAGGAGAC TCCCAAGTTT TTACAAGCAA AAGAGCTATT
ATTTCTATTC TTCATGGGCA TATGCAATAC CAGCTTCAGT CCTAAAGGTC CCTGTTTCCA TATTAGATTC ACTTGTATGG
ATATGTATCA CATATTACGG TATTGGTTAT ACAGCTAGTG TTTCGAGGTA AATAATTTAT TGGAGATTTG GCAAGTTTTC
AACGATAAGA ACAAACATTG AGAAACTCTT TAACACAATT TATTTATACC CATTTGTAGG TTCTTCTGCC AATTTCTGAT
GCTTTGTTTT GTCCATCAAT CAGTCACTTC GCTGTATCGA TTTATTGCTT CATACTTCCA AACACCTACT GCGTCTTTCT
TCTACCTTTT TCTGGCTCTA ACATTCTTCC TCATGTTTGG AGGCTTCACT CTTCCCAAGC GTAAGATAAC CATCGCTCAT
TGTGCATATA AACCTAGCAA AAATAAACAT ATTGTGTTAC TTTGTTTTTC CAGCCTCCAT GCCAGGATGG TTAAACTGGG
GATTTTGGAT TTCTCCAATG ACATATGCAG AAATCGGCAC AGTTATTAAT GAATTCCAAG CGCCAAGATG GCAGAAGGTG
AAATATGTTT TTTTTTCAAA TAAAAAAAAA TGAGTTATCA GCTGCTTTCA AGCATTTACA TCATTGCTAC TTGTATTATT
TTCAGGAAAC TATTCAAAAC ATAACAATTG GGAACCGAAT CCTGATTAAT CATGGCCTAT ATTACAGTTG GCACTTTTAT
TGGATATCCA TTGGAGCATT GTTCGGATCA ATCATTTTAT TTTATATCGC TTTTGGATTG GCGCTAGATT ATATTACATG
TAAGTTTGCT ACCATTGAAC AAAGTGCATA TTTCTCAGAC TCGAGCTCCA TGGTACTCAG GCAGCATAAT TTGACATACA
GTGAACTTGG GGTAATGCTT TTGGAAATCT CTATTTTAGG GAATACACCT GGTTGTGATT ACTGGGCGTA ATTTCTGAAA
TATCTACTCG ATTTCCGATG TTTTTTGAAT ATATTCACAT AGCAGATtta tatacataat ctgcagatac ctacaatcca
ataataaatg acaaaagaaa atacaatttg aaattttgtt caaacttgtt tggagtggtt tatgattaaa ttagacccca
caaaattcca tgccatatat cgtgacaaga ctgcagatat ggggatgtag agctggggca ctatggagca ccagttaatt
tgactttata tacgcatatt atttaCTTGA GAAACAAATT ATAAATTTGC CTATTTCAGC TATAGAAGAA TATCATGGAA
GTAGGCCTAT AAAGAGGTTA TGTCAAGAAC AGGAAAAAGA TTCTAATATA CGAAAAGAAT CTGATGGTCA TTCAAATATT
TCCAGAGGTA AAGACATAAA CATCTCAATA TCAAGTAATA GTAAGAAATG AAGGTCCCAC AAAAAAAAGT AACAAACCAA
GTTAGCAGAG TTGCGTTTCG AAAGCAAAAT GCATGCTTCT TCAATGCATT GATCTTTTTG CAGCAAAGAT GACTATACCT
GTTATGGAAC TTCCAATTAC GTTCCACAAT CTGAACTACT ACATTGATAC CCCACCGGTA ATTAAGAAAG CTCCCTATGT
ATTTGATTTT TACAGTTTTT GTGTTTCTCG TCTGGTTCAT ATTTGAAGAT AAAGGTATGT AAGAAATGTA CTCTCTTGTA
GGAAATGCTG AAACAAGGCT ATCCAACAAA AAGACTTCAA CTACTTAACA ACATAACTGG TGCATTGCGT CCCGGTGTTC
TTTCTGCACT AATGGGTGTC AGTGGAGCCG GGAAGACAAC TCTGCTAGAT GTATTAGCAG GAAGGAAAAC AGGAGGATAT
ATTGAAGGGG ACATAAGAAT AGGTGGATAT CCCAAGGTGC AAGAAACATT TGTTAGAATC TTAGGTTACT GTGAGCAAGC
CGACATACAT TCCCCACAGC TCACAGTTGA AGAGTCTGTA ACTTATTCTG CTTGGCTTCG TCTACCTTCT CATGTCGACA
AAAAAACAAG ATCTGTATGT CCCTTGGAAG TTGGAACAAC ACAGACATAT ACTGATTTTA ATAACAGATA GATAAACAAG
AAGCTTACCT 

Locus: Os12g0512700

Loading...

Locus: Os12g0512700

Loading...