Os12t0515300-01

Locus

Os12g0515300

Description

MYB transcription factor, Regulation of secondary wall biosynthesis

RAP-DB Gene Symbol Synonym(s)

OsMYB46

RAP-DB Gene Name Synonym(s)

MYB transcription factor 46

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsMYB46

Oryzabase Gene Name Synonym(s)

MYB transcription factor 46

Transcript Evidence

JN634084

Protein Evidence

Q2QPW4

Literature

PMID: 21908441

Note

Manual Curation

October 20, 2020

Gene Ontology (GO)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

Homeobox-like domain superfamily (IPR009057)

SANT/Myb domain (IPR001005)

Myb domain (IPR017930)

Expression Databases

TENOR (Os12t0515300-00)

Others

Oryzabase (15024)

Transcript

1263 bp

>Os12t0515300-01 MYB transcription factor, Regulation of secondary wall biosynthesis
AGATCGGCAATGAGGAAGCCGGATTGCGGCGGCGGGGGAGGGGCGGCGAAGGGCGGCGGC
GTTCTGGGTGTGGCGGGAGGGAACAATGCGGCGGTGGTGGGGGGGAAGGTTCGGAAGGGG
CTGTGGTCGCCGGAGGAGGACGAGAAGCTGGTGGCGTACATGCTGCGGAGCGGGCAGGGG
TCGTGGAGCGACGTGGCGAGGAACGCCGGGCtgcagcgctgcggcaagagctgccgcctc
cggtggatcaactacctccgccccgacctcaagcgcggcgccttctcgccgcaggaggag
gacctcatcgtcaacctccacgccatcctcggcaacaggtggtctcagatcgctgcccgg
ctaccggggcgcaccgacaacgagatcaagaacttctggaactccaccatcaagaagcgc
ctcaagatctcctcctcctcggcgtctccggccaccaccaccgactgcgcctccccgccg
gagcacaagctcggcgccgtcgtcgacctcgccggcggcggcggcgccacggacgacGTC
GTTGTCGGGACAGCTAATGCTGCCATGAAGAGCATGTGGGTGGATTCCTCGTCGTCGTCG
TCGTCGTCTTCCTCGTCGATGCAGAGCCGGCCGTCGATAATGGCGGCGGCGGCGGCGGGG
AGGAGCTACGGCGGCCTCCTCCCACTCCCCGACCAGGTCTGCGGCGTCGACACCTCGCCG
CCACCGCCGTTCTTCCACGACCACTCCATCTCCATCAAGCAAGCATACTACGGATCAACC
GGCGCCCACCACCACCACCACGCGATCGCCACCATGGACGGATCAAGCTTAATAGGAGAT
CATCACCATCACAGCAGCAGCATCCTCTTTGGCGGCGCATCAGTGCCACCTCTCCTAGAC
CACCAAACCATTCTCGACGACGACGACGACCACCCTAACAAAACCGGCAGCAACACGACC
GCGGCCACACTGAGCAGCAACATCACAGACAACAGCAACAGCAACAAGAACAACAGTGAT
AATAACAACAACATCAGCAGCAGCTGCTGCATTAGCCTAATGAACAGCAGCAGCAACATG
ATCTATTGGGAGGGTCACCACCAACAACAGCAGCAGCAGCATCAGATGCTGCAGCAGCAG
CAGCAGCACATGAGCAGGAATGTCATGGGAGAGTGGGACTTGGAGGAGCTGATGAAAGAT
GTGTCATCCTTGCCTTTCCTTGATTTCCAAGTTGAATGATTGAGAGGGAGGGGCCCCATC
TAT

CDS

1230 bp

>Os12t0515300-01 MYB transcription factor, Regulation of secondary wall biosynthesis
ATGAGGAAGCCGGATTGCGGCGGCGGGGGAGGGGCGGCGAAGGGCGGCGGCGTTCTGGGT
GTGGCGGGAGGGAACAATGCGGCGGTGGTGGGGGGGAAGGTTCGGAAGGGGCTGTGGTCG
CCGGAGGAGGACGAGAAGCTGGTGGCGTACATGCTGCGGAGCGGGCAGGGGTCGTGGAGC
GACGTGGCGAGGAACGCCGGGCtgcagcgctgcggcaagagctgccgcctccggtggatc
aactacctccgccccgacctcaagcgcggcgccttctcgccgcaggaggaggacctcatc
gtcaacctccacgccatcctcggcaacaggtggtctcagatcgctgcccggctaccgggg
cgcaccgacaacgagatcaagaacttctggaactccaccatcaagaagcgcctcaagatc
tcctcctcctcggcgtctccggccaccaccaccgactgcgcctccccgccggagcacaag
ctcggcgccgtcgtcgacctcgccggcggcggcggcgccacggacgacGTCGTTGTCGGG
ACAGCTAATGCTGCCATGAAGAGCATGTGGGTGGATTCCTCGTCGTCGTCGTCGTCGTCT
TCCTCGTCGATGCAGAGCCGGCCGTCGATAATGGCGGCGGCGGCGGCGGGGAGGAGCTAC
GGCGGCCTCCTCCCACTCCCCGACCAGGTCTGCGGCGTCGACACCTCGCCGCCACCGCCG
TTCTTCCACGACCACTCCATCTCCATCAAGCAAGCATACTACGGATCAACCGGCGCCCAC
CACCACCACCACGCGATCGCCACCATGGACGGATCAAGCTTAATAGGAGATCATCACCAT
CACAGCAGCAGCATCCTCTTTGGCGGCGCATCAGTGCCACCTCTCCTAGACCACCAAACC
ATTCTCGACGACGACGACGACCACCCTAACAAAACCGGCAGCAACACGACCGCGGCCACA
CTGAGCAGCAACATCACAGACAACAGCAACAGCAACAAGAACAACAGTGATAATAACAAC
AACATCAGCAGCAGCTGCTGCATTAGCCTAATGAACAGCAGCAGCAACATGATCTATTGG
GAGGGTCACCACCAACAACAGCAGCAGCAGCATCAGATGCTGCAGCAGCAGCAGCAGCAC
ATGAGCAGGAATGTCATGGGAGAGTGGGACTTGGAGGAGCTGATGAAAGATGTGTCATCC
TTGCCTTTCCTTGATTTCCAAGTTGAATGA

Protein

410 aa

>Os12t0515300-01 MYB transcription factor, Regulation of secondary wall biosynthesis
MRKPDCGGGGGAAKGGGVLGVAGGNNAAVVGGKVRKGLWSPEEDEKLVAYMLRSGQGSWS
DVARNAGLQRCGKSCRLRWINYLRPDLKRGAFSPQEEDLIVNLHAILGNRWSQIAARLPG
RTDNEIKNFWNSTIKKRLKISSSSASPATTTDCASPPEHKLGAVVDLAGGGGATDDVVVG
TANAAMKSMWVDSSSSSSSSSSSMQSRPSIMAAAAAGRSYGGLLPLPDQVCGVDTSPPPP
FFHDHSISIKQAYYGSTGAHHHHHAIATMDGSSLIGDHHHHSSSILFGGASVPPLLDHQT
ILDDDDDHPNKTGSNTTAATLSSNITDNSNSNKNNSDNNNNISSSCCISLMNSSSNMIYW
EGHHQQQQQQHQMLQQQQQHMSRNVMGEWDLEELMKDVSSLPFLDFQVE*

5'UTR

chr12:19994402..19994410 (- strand) : 9 bp

CDS

chr12:19994073..19994401 (- strand) : 329 bp

chr12:19991426..19992326 (- strand) : 901 bp

3'UTR

chr12:19991402..19991425 (- strand) : 24 bp

FASTA

>Os12t0515300-01 class=Sequence position=chr12:19991402..19994410 (- strand)
AGATCGGCAA TGAGGAAGCC GGATTGCGGC GGCGGGGGAG GGGCGGCGAA GGGCGGCGGC GTTCTGGGTG TGGCGGGAGG
GAACAATGCG GCGGTGGTGG GGGGGAAGGT TCGGAAGGGG CTGTGGTCGC CGGAGGAGGA CGAGAAGCTG GTGGCGTACA
TGCTGCGGAG CGGGCAGGGG TCGTGGAGCG ACGTGGCGAG GAACGCCGGG Ctgcagcgct gcggcaagag ctgccgcctc
cggtggatca actacctccg ccccgacctc aagcgcggcg ccttctcgcc gcaggaggag gacctcatcg tcaacctcca
cgccatcctc ggcaacaggt GCAGCTAATC AGTTAACTAT AAGCTCCTAC GACTAAGTAG TACCTAATTA ATTAATTACC
ATGATTAATT AAGCTTTAAT ATATTAGGAG ATTGATTCAT TAATTACTTC ATTGTCTTTG TAATGTGGGG GTTCATATTG
TGTGTTCTTC TTTGTTCGTT CGTTTCTCAT CGGTTTTTCT TAAGTAGTTT GCTTGTCTTC TTCCTACATT AATTTGTTTC
TTGTTTTTCA CAAAGTGCTA GCTTTTTCTG TGTGTGTTTA ATTTGTTTTG TTTTCTCGTT TGGAATGTTG TTATATTGTG
TTGATAGGGC TAGCAAGTAA TGTAGCATAA TCTTTCAATG AATTTCCCTC GCAATTAAAA GATATATATA CTGTTCTTTT
TTTAAAAAAA AATCTCTCTC TGGGTGTGTA TTAATTGTTT TCCTCTGGTT TCTCTTTTTT TTTTGAGATG GTGTTGATTT
TGTTTATAAT TCTCTGTGGT GCTCTGATCT ACACATGCAT TTCTCCAAAA AAAAAGTATA TAAGAGATTA CGTGAATTTG
ACACAATACG TCGTACGATA TTTTTTTCCC ATGTACACTG TCCTAGTTCA CAACTGTCTT AGGTAGATCT ACCGTGAGCG
TACAATTTCC GTATTCTACA GCTGAAGCAT TACAGATCAC GTACAGCAAA ACGTTGACGT GCATATACTC ATGCATGCAT
ATACATTTAT AATATGTGAC ATAAGTTAAA AAAATTTGAT TATTAGAATA TTAATATATA TACAGACATG TGTCTCAAGT
CTCAAAGGGC TATGAGAACA ACATGAGTCC TGGATATATC AATCAAAATA TTTCTTGATT AATTCTTTTT TTTCTTCTGC
TTAATTTTGC ATGAAATGTC GTACACCATG CATAATTACA AAACTGATAT ATATGTAACG TAGAAACTAA AAGTTGCCTG
AAAAGACACC GAAAGGGATA CTTCATACTT GTATACGTTC TAATTAACCC TGAAAGACAT ATGCAAATTT GTCGGATCCA
ATCATCCATA ATTATTGATT AATCCTTGTC TTACCAGAAA TGAGATTATG ACATCGACTA ATTACCTCTA CGTACTTTCT
CACATGTAAA ACTAACCTAT ATATATATAT ATATATATAT ATATATATAT ATATATATAT ATATATATAT ATATATATAT
ATATATATGC TTTTCGTTTT ACCTAAAAAA ACCTTTtcat tttagctttg tataaagtca aatattcatc ataaattttc
aaaaattcgt atacagttta acatgtgaat tatatattat gaaaatattt ctcatatata atgaatttag aaaataaatc
ttattatggt aataactgta taaatttcta gagaattgat gatgaaggtt agaaatgttt gacttaCTGC AAAGTTATAA
CGACAAGTAA TTTTTTTAAG TAAAACAACA AGTAATTTGA AACGGAGAAA ATCATATATA TTTTATCTTT ATTTTTTTTT
GGAAGTAAAT ACTAGATTAA TCATGCTTAT GCGCTTATGC ATGCATGCAT GCATGCATAA AAAGAAGATT AATTAAGGCG
CATTGACATA TATGTGCATG CAGCTAATTA ACCTTTTTAT TTAATTAATC TTTTGTACTA CAACCATAGC TATAGCTAAG
CTTGGATAAT AATTCTTGAC AGAAACATCT CGTTTGCTCA CTGATGAAAA ATCTACcgta ctacgacgca tggaattatt
gcaggtggtc tcagatcgct gcccggctac cggggcgcac cgacaacgag atcaagaact tctggaactc caccatcaag
aagcgcctca agatctcctc ctcctcggcg tctccggcca ccaccaccga ctgcgcctcc ccgccggagc acaagctcgg
cgccgtcgtc gacctcgccg gcggcggcgg cgccacggac gacGTCGTTG TCGGGACAGC TAATGCTGCC ATGAAGAGCA
TGTGGGTGGA TTCCTCGTCG TCGTCGTCGT CGTCTTCCTC GTCGATGCAG AGCCGGCCGT CGATAATGGC GGCGGCGGCG
GCGGGGAGGA GCTACGGCGG CCTCCTCCCA CTCCCCGACC AGGTCTGCGG CGTCGACACC TCGCCGCCAC CGCCGTTCTT
CCACGACCAC TCCATCTCCA TCAAGCAAGC ATACTACGGA TCAACCGGCG CCCACCACCA CCACCACGCG ATCGCCACCA
TGGACGGATC AAGCTTAATA GGAGATCATC ACCATCACAG CAGCAGCATC CTCTTTGGCG GCGCATCAGT GCCACCTCTC
CTAGACCACC AAACCATTCT CGACGACGAC GACGACCACC CTAACAAAAC CGGCAGCAAC ACGACCGCGG CCACACTGAG
CAGCAACATC ACAGACAACA GCAACAGCAA CAAGAACAAC AGTGATAATA ACAACAACAT CAGCAGCAGC TGCTGCATTA
GCCTAATGAA CAGCAGCAGC AACATGATCT ATTGGGAGGG TCACCACCAA CAACAGCAGC AGCAGCATCA GATGCTGCAG
CAGCAGCAGC AGCACATGAG CAGGAATGTC ATGGGAGAGT GGGACTTGGA GGAGCTGATG AAAGATGTGT CATCCTTGCC
TTTCCTTGAT TTCCAAGTTG AATGATTGAG AGGGAGGGGC CCCATCTAT

Locus: Os12g0515300

Loading...

Locus: Os12g0515300

Loading...