Os12t0545900-02

Locus

Os12g0545900

Description

Conserved hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PMS3

CGSNL Gene Name

PHOTOPERIOD SENSITIVE GENIC MALE STERILITY 3

Oryzabase Gene Symbol Synonym(s)

pms3, LDMAR

Oryzabase Gene Name Synonym(s)

photoperiod-sensitive genic male sterility3, long-day-specific male-fertility-associated RNA

Transcript Evidence

AK071577 (DDBJ, Best hit)

Protein Evidence

Q5QLU3 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

J023107K05 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0545900-02)

Others

Oryzabase (2286)

Transcript

780 bp

>Os12t0545900-02 Conserved hypothetical protein.
cttcggccttttctcgctccccttcctcctgcgcacgcgttctcccgatgcgccgccgcc
tcctgctcctcacgccaccgttctgtgccgccggccccgcaagggaccaccgcgccgccc
cgcctcggaaaccgcctgggcgccgccacctcctgccgccgtcacctgcgccgacttcgc
gaggagccgccgcgtcgcctgccttgggaagccgccgcctgccacctgggagcacccgcc
gtcgaagtccggcgccggttcctcgccgggaaccgccgccgccgccgcaagctcctgccc
gagctacgacgaacgccgcgccgagcaccacgccgctgcacgccgcctgcaatgacgcct
ccagccgcccgtgaactcgccgccccaaaccacgctgcccacgaaatcagagCTCCGCCA
CCTTGTGCCCCGCCATCGCCGTCGCTCGCTCGCTCGCTCATGAGCTGTTGCTTGTTTTGC
CGCTGCGACTCGCCGTTCCTAGCCTCGCCGCCGACATATCCACTCACGAGCTCGCACCCG
CCACCGTCGTCGCCATCGCCTGTTCTCGGCCAGGGTTAGGATTGGAGCAGCATAGAGAAC
AAGCGACGACTACATAACCTAGTATATATAGTAGTATTTTTCTTTCAACTACTTGCAAGC
GTGAGCTTCTTCAGTTGACCCAAATTGAACAACATATTATGGAATTTATCAGGATGTACG
ATCCTTCATTATTTCTACATCCTCCATTTCAAAATGAGTTAACCTAttgttcagatttgc

CDS

354 bp

>Os12t0545900-02 Conserved hypothetical protein.
ttcggccttttctcgctccccttcctcctgcgcacgcgttctcccgatgcgccgccgcct
cctgctcctcacgccaccgttctgtgccgccggccccgcaagggaccaccgcgccgcccc
gcctcggaaaccgcctgggcgccgccacctcctgccgccgtcacctgcgccgacttcgcg
aggagccgccgcgtcgcctgccttgggaagccgccgcctgccacctgggagcacccgccg
tcgaagtccggcgccggttcctcgccgggaaccgccgccgccgccgcaagctcctgcccg
agctacgacgaacgccgcgccgagcaccacgccgctgcacgccgcctgcaatga

Protein

118 aa

>Os12t0545900-02 Conserved hypothetical protein.
FGLFSLPFLLRTRSPDAPPPPAPHATVLCRRPRKGPPRRPASETAWAPPPPAAVTCADFA
RSRRVACLGKPPPATWEHPPSKSGAGSSPGTAAAAASSCPSYDERRAEHHAAARRLQ*

5'UTR

chr12:22047716..22047716 (+ strand) : 1 bp

CDS

chr12:22047717..22048070 (+ strand) : 354 bp

3'UTR

chr12:22048071..22048127 (+ strand) : 57 bp

chr12:22050048..22050415 (+ strand) : 368 bp

FASTA

>Os12t0545900-02 class=Sequence position=chr12:22047716..22050415 (+ strand)
cttcggcctt ttctcgctcc ccttcctcct gcgcacgcgt tctcccgatg cgccgccgcc tcctgctcct cacgccaccg
ttctgtgccg ccggccccgc aagggaccac cgcgccgccc cgcctcggaa accgcctggg cgccgccacc tcctgccgcc
gtcacctgcg ccgacttcgc gaggagccgc cgcgtcgcct gccttgggaa gccgccgcct gccacctggg agcacccgcc
gtcgaagtcc ggcgccggtt cctcgccggg aaccgccgcc gccgccgcaa gctcctgccc gagctacgac gaacgccgcg
ccgagcacca cgccgctgca cgccgcctgc aatgacgcct ccagccgccc gtgaactcgc cgccccaaac cacgctgccc
acgaaatcag aggtaagatc tcgcccttgc cttgtggttt gtttcgattg cgttgttgca atcccgtggt cctccgctgc
ttttatttgg gaaaaatcga gtcccattca tggacagatc gtaatcctcg tccgattccc cttccgtgct tgactaggtc
tctccctcaa tctgtttctc tattgtgcta tgcatccgag ttggaaacat atccgactcc ttccatgtca caacctctcc
agatcgagtc ctgtgcaatc cgacttcctg ctactcaggc tctggccacg ttccatggtc ccggcttcaa caccaacacg
tgcacaccgc catctccgtg acctcctcag cctccacgca cccgtacgac ctctagcgta gccacctagc ctcccgctga
acctcgccag tgacgaatac cgccggtcag ttgcaaccaa tgcttattgc tgtgctaaca caattgatca gcgcattgac
ggtctgaaat tgactgccct tctgcttgat tccgtcgctt ttcatatgtg cgctttctcc gtagcagtct gtcacgcaaa
tacctcgtca acacctccaa aacagcctat aggatccaca cgctccgact tttgattgaa cgccatcaat ctaatcgcga
gccgaagccg ataagtcgca tgccgtcttc ccagccaccg aacgatccga gcgctacgtc tagccgtctc cctgtcgaac
gtagcttatc gaaaggcccg ggccaccccg cccagagtgt tcgaatccac cgatcgagaa cgccgatcgc ctccagcttc
aatcaacccg agcatgcggc cgcacgtctc cctgtcgaga gtagctcacc ggaaagtccg agccacccgc ccgaagtgtc
cgacccaccg attggatcgc caatcgcttc cgccgccatc aacccgagca ccacgtctag tcatctccct gttgaaagca
gccatcgacg gttccggccg ccgccagaag tgttcgatcc accgatcaag actccattga tcgccgccgt gctccacctt
gcaccaatgc ccctccctgg gcattacagc aggctatgcg gtgtggagca cctccattgc gcctctacca tggaccttct
gcaggctctg ataccacttg ttataaaacc agccctgaaa tcaacatcgg tagctaaaac gcggaagaaa acgccattgg
agatccaaaa caatgacgac accgagacac aatatttggt aacggagttc agccgtagcc tacatctccg aggcactgat
tacgggctct cctccccgat ccagcatata cagcgtatca gagttacaac gactcatggc cggtcgatgc cggcagccgc
tccctctcgc tatgctaagt cgctatgcgg ttacaacagg cacgcccctc tatttatgag agaacctagg atagagtccg
actcatactc tagtcctaat acctattaca actccaagtc ctaaactgta accgactacg tacacatatt cgacacaaac
tctaacaGTG GCTATGGTTG GAAAACAATT ATATAACAAG ATCAGATTAC CTACGGTTGG AAGAAAAAGA AATTGAAAGT
GTTGGACCGA TAAAATAATT TGTTTTTCCA AAATTGGTCG GTTCAGTGAA ATAAGCGTGT GGAGAGTcat attgtccatt
cgttttattc aaaaactttt gtaaaatatg taaaacataa aaatatattt aacaataaat caaatgatag gaaaataatt
aataattact taaatttttc gaataagatg aacggtcaaa catgttaaaa aaaatcaacg gcgtcaaata tttaggaacg
gagggagtaC TTTATAAGAA AAATTCCATA TATACCTCTA ATTTTTTATT GAAAAAGACC GTCTCATGCC CTGCCATTGT
CATTGCTCAC AGCTCCGCCA CCTTGTGCCC CGCCATCGCC GTCGCTCGCT CGCTCGCTCA TGAGCTGTTG CTTGTTTTGC
CGCTGCGACT CGCCGTTCCT AGCCTCGCCG CCGACATATC CACTCACGAG CTCGCACCCG CCACCGTCGT CGCCATCGCC
TGTTCTCGGC CAGGGTTAGG ATTGGAGCAG CATAGAGAAC AAGCGACGAC TACATAACCT AGTATATATA GTAGTATTTT
TCTTTCAACT ACTTGCAAGC GTGAGCTTCT TCAGTTGACC CAAATTGAAC AACATATTAT GGAATTTATC AGGATGTACG
ATCCTTCATT ATTTCTACAT CCTCCATTTC AAAATGAGTT AACCTAttgt tcagatttgc 

Locus: Os12g0545900

Loading...

Locus: Os12g0545900

Loading...