Os12t0545900-03

Locus

Os12g0545900

Description

Conserved hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PMS3

CGSNL Gene Name

PHOTOPERIOD SENSITIVE GENIC MALE STERILITY 3

Oryzabase Gene Symbol Synonym(s)

pms3, LDMAR

Oryzabase Gene Name Synonym(s)

photoperiod-sensitive genic male sterility3, long-day-specific male-fertility-associated RNA

Transcript Evidence

AK100176 (DDBJ, Best hit)

Protein Evidence

Q5QLU3 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

J023029D09 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0545900-03)

Others

Oryzabase (2286)

Transcript

1035 bp

>Os12t0545900-03 Conserved hypothetical protein.
cggccttttctcgctccccttcctcctgcgcacgcgttctcccgatgcgccgccgcctcc
tgctcctcacgccaccgttctgtgccgccggccccgcaagggaccaccgcgccgccccgc
ctcggaaaccgcctgggcgccgccacctcctgccgccgtcacctgcgccgacttcgcgag
gagccgccgcgtcgcctgccttgggaagccgccgcctgccacctgggagcacccgccgtc
gaagtccggcgccggttcctcgccgggaaccgccgccgccgccgcaagctcctgcccgag
ctacgacgaacgccgcgccgagcaccacgccgctgcacgccgcctgcaatgacgcctcca
gccgcccgtgaactcgccgccccaaaccacgctgcccacgaaatcagagTGTACGTAGCC
TACGCAAAAATAGGATTGGGAGTCAAAAGGAAGAAACGAAGCATATCGTGAATTGGTCAG
CCAGCCACATTACCAATTTTCTCCGGCAGCATTGAGGTATAGAAATCATAATAGACATTA
GAGTCTAGCTCTCGGCTGGTTGATCTTCCACACACTGTAACTGTTGGTGTAGTTTAACAA
ACCGATGAAGCAATGTAGTGGAGATGCTCTAGTTGTCCAGACGAGAAATGGCGGCACTGA
AGCTGGTCAGATCAGGATGAAGCAGCAAAGGCCTGCCGTTGTTGGCCAAGAAATTCTGAA
ACTATCAAGTACACCTTCAGGATCAATATATGGTAGCATCATCCTTTTGAAGCGTCGTCT
AAAATCCTTACGTACCAAGCCCTGTTAGCTCAGTTTTTCTACTGAACATGAACACATTTA
CTTGTCTATAGCTAGCTAGTATTTGTCGATCCGGAGGTTAGAAACACAAACAAAAATGAT
ATCGTGGTCCGACCAAAATGGGACGGACATACCCCACAATGGCGCCGTGTGGACCCAACT
GAAACATTGGGTAGTTGGCGACAGCTCTTTTGGGCTGAAACTTCTAAGTTTTCAAGTGAT
GAGGTATATTCTATT

CDS

351 bp

>Os12t0545900-03 Conserved hypothetical protein.
ggccttttctcgctccccttcctcctgcgcacgcgttctcccgatgcgccgccgcctcct
gctcctcacgccaccgttctgtgccgccggccccgcaagggaccaccgcgccgccccgcc
tcggaaaccgcctgggcgccgccacctcctgccgccgtcacctgcgccgacttcgcgagg
agccgccgcgtcgcctgccttgggaagccgccgcctgccacctgggagcacccgccgtcg
aagtccggcgccggttcctcgccgggaaccgccgccgccgccgcaagctcctgcccgagc
tacgacgaacgccgcgccgagcaccacgccgctgcacgccgcctgcaatga

Protein

117 aa

>Os12t0545900-03 Conserved hypothetical protein.
GLFSLPFLLRTRSPDAPPPPAPHATVLCRRPRKGPPRRPASETAWAPPPPAAVTCADFAR
SRRVACLGKPPPATWEHPPSKSGAGSSPGTAAAAASSCPSYDERRAEHHAAARRLQ*

5'UTR

chr12:22047719..22047719 (+ strand) : 1 bp

CDS

chr12:22047720..22048070 (+ strand) : 351 bp

3'UTR

chr12:22048071..22048127 (+ strand) : 57 bp

chr12:22050602..22051227 (+ strand) : 626 bp

FASTA

>Os12t0545900-03 class=Sequence position=chr12:22047719..22051227 (+ strand)
cggccttttc tcgctcccct tcctcctgcg cacgcgttct cccgatgcgc cgccgcctcc tgctcctcac gccaccgttc
tgtgccgccg gccccgcaag ggaccaccgc gccgccccgc ctcggaaacc gcctgggcgc cgccacctcc tgccgccgtc
acctgcgccg acttcgcgag gagccgccgc gtcgcctgcc ttgggaagcc gccgcctgcc acctgggagc acccgccgtc
gaagtccggc gccggttcct cgccgggaac cgccgccgcc gccgcaagct cctgcccgag ctacgacgaa cgccgcgccg
agcaccacgc cgctgcacgc cgcctgcaat gacgcctcca gccgcccgtg aactcgccgc cccaaaccac gctgcccacg
aaatcagagg taagatctcg cccttgcctt gtggtttgtt tcgattgcgt tgttgcaatc ccgtggtcct ccgctgcttt
tatttgggaa aaatcgagtc ccattcatgg acagatcgta atcctcgtcc gattcccctt ccgtgcttga ctaggtctct
ccctcaatct gtttctctat tgtgctatgc atccgagttg gaaacatatc cgactccttc catgtcacaa cctctccaga
tcgagtcctg tgcaatccga cttcctgcta ctcaggctct ggccacgttc catggtcccg gcttcaacac caacacgtgc
acaccgccat ctccgtgacc tcctcagcct ccacgcaccc gtacgacctc tagcgtagcc acctagcctc ccgctgaacc
tcgccagtga cgaataccgc cggtcagttg caaccaatgc ttattgctgt gctaacacaa ttgatcagcg cattgacggt
ctgaaattga ctgcccttct gcttgattcc gtcgcttttc atatgtgcgc tttctccgta gcagtctgtc acgcaaatac
ctcgtcaaca cctccaaaac agcctatagg atccacacgc tccgactttt gattgaacgc catcaatcta atcgcgagcc
gaagccgata agtcgcatgc cgtcttccca gccaccgaac gatccgagcg ctacgtctag ccgtctccct gtcgaacgta
gcttatcgaa aggcccgggc caccccgccc agagtgttcg aatccaccga tcgagaacgc cgatcgcctc cagcttcaat
caacccgagc atgcggccgc acgtctccct gtcgagagta gctcaccgga aagtccgagc cacccgcccg aagtgtccga
cccaccgatt ggatcgccaa tcgcttccgc cgccatcaac ccgagcacca cgtctagtca tctccctgtt gaaagcagcc
atcgacggtt ccggccgccg ccagaagtgt tcgatccacc gatcaagact ccattgatcg ccgccgtgct ccaccttgca
ccaatgcccc tccctgggca ttacagcagg ctatgcggtg tggagcacct ccattgcgcc tctaccatgg accttctgca
ggctctgata ccacttgtta taaaaccagc cctgaaatca acatcggtag ctaaaacgcg gaagaaaacg ccattggaga
tccaaaacaa tgacgacacc gagacacaat atttggtaac ggagttcagc cgtagcctac atctccgagg cactgattac
gggctctcct ccccgatcca gcatatacag cgtatcagag ttacaacgac tcatggccgg tcgatgccgg cagccgctcc
ctctcgctat gctaagtcgc tatgcggtta caacaggcac gcccctctat ttatgagaga acctaggata gagtccgact
catactctag tcctaatacc tattacaact ccaagtccta aactgtaacc gactacgtac acatattcga cacaaactct
aacaGTGGCT ATGGTTGGAA AACAATTATA TAACAAGATC AGATTACCTA CGGTTGGAAG AAAAAGAAAT TGAAAGTGTT
GGACCGATAA AATAATTTGT TTTTCCAAAA TTGGTCGGTT CAGTGAAATA AGCGTGTGGA GAGTcatatt gtccattcgt
tttattcaaa aacttttgta aaatatgtaa aacataaaaa tatatttaac aataaatcaa atgataggaa aataattaat
aattacttaa atttttcgaa taagatgaac ggtcaaacat gttaaaaaaa atcaacggcg tcaaatattt aggaacggag
ggagtaCTTT ATAAGAAAAA TTCCATATAT ACCTCTAATT TTTTATTGAA AAAGACCGTC TCATGCCCTG CCATTGTCAT
TGCTCACAGC TCCGCCACCT TGTGCCCCGC CATCGCCGTC GCTCGCTCGC TCGCTCATGA GCTGTTGCTT GTTTTGCCGC
TGCGACTCGC CGTTCCTAGC CTCGCCGCCG ACATATCCAC TCACGAGCTC GCACCCGCCA CCGTCGTCGC CATCGCCTGT
TCTCGGCCAG GGTTAGGATT GGAGCAGCAT AGAGAACAAG CGACGACTAC ATAACCTAGT ATATATAGTA GTATTTTTCT
TTCAACTACT TGCAAGCGTG AGCTTCTTCA GTTGACCCAA ATTGAACAAC ATATTATGGA ATTTATCAGG ATGTACGATC
CTTCATTATT TCTACATCCT CCATTTCAAA ATGAGTTAAC CTAttgttca gatttgcagt actagcatat tcaatattag
attaacttat tttggtacga agagagtaca tTAATTGTTC ATGTTGCTTC CTAACCGATA AAAGGAGAAC AAAGAGAAGA
GTAACCATCG TCAATGGAGA AATCCTTTGT CATATCTTAC ATACCCATGA AAGGTTCAAT GCATCACAAG TGTATTTGTG
CAGTGTACGT AGCCTACGCA AAAATAGGAT TGGGAGTCAA AAGGAAGAAA CGAAGCATAT CGTGAATTGG TCAGCCAGCC
ACATTACCAA TTTTCTCCGG CAGCATTGAG GTATAGAAAT CATAATAGAC ATTAGAGTCT AGCTCTCGGC TGGTTGATCT
TCCACACACT GTAACTGTTG GTGTAGTTTA ACAAACCGAT GAAGCAATGT AGTGGAGATG CTCTAGTTGT CCAGACGAGA
AATGGCGGCA CTGAAGCTGG TCAGATCAGG ATGAAGCAGC AAAGGCCTGC CGTTGTTGGC CAAGAAATTC TGAAACTATC
AAGTACACCT TCAGGATCAA TATATGGTAG CATCATCCTT TTGAAGCGTC GTCTAAAATC CTTACGTACC AAGCCCTGTT
AGCTCAGTTT TTCTACTGAA CATGAACACA TTTACTTGTC TATAGCTAGC TAGTATTTGT CGATCCGGAG GTTAGAAACA
CAAACAAAAA TGATATCGTG GTCCGACCAA AATGGGACGG ACATACCCCA CAATGGCGCC GTGTGGACCC AACTGAAACA
TTGGGTAGTT GGCGACAGCT CTTTTGGGCT GAAACTTCTA AGTTTTCAAG TGATGAGGTA TATTCTATT

Locus: Os12g0545900

Loading...

Locus: Os12g0545900

Loading...