Os12t0551600-00

Locus

Os12g0551600

Description

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OspPLAIIkappa, pPLAIIkappa

Oryzabase Gene Name Synonym(s)

Patatin-related phospholipase A II kappa

Transcript Evidence

Protein Evidence

Literature

Note

Manual Curation

Expression Databases

TENOR (Os12t0551600-00)

Others

Oryzabase (19869)

Transcript

1314 bp

>Os12t0551600-00
ATGCTTCGCTTCACCACTGCTCGTCTCCTCCGGCCTCGGTGCCGGCGTCTCTATCATGGC
TGCAGCGACGGCGCGGCGGCGTGCAGTGTCGTCGGCGAGAGGGTGACGGTGCTGACCATC
GATGGCGGCGGCATCCGGGGGATCATCCCGGGCAAGGTGCTCGAGTTCTTGGAGAACGAG
CTCCAGCAGCTGGATGGGCCAGAGGCGAGGCTGGCCGACTACTTCGACTACATCGCCGGG
ACGAGCACCGGCGGGCTGATCACCGCGATGCTGGCCGCGCCCGGCGCCGGCGGGGACGGA
CGGCGGCGGCCGCTGTTCGCCGCCAAGGAGATTTGTCCGTTCTACCAGGAGCACGGCCCG
CGCATCTTCCCCCAGAGGTGGTGCAAGCTCGCCTCCACTGTCGCCGCGGTGTGGGGGCCC
AAGTACAACGGTAGGTACCTCCGCAACATGGTCCGGGAGGTGCTCGGCGAAATGACGGTG
GGCGACACGCTCACCAATGTCGTCATCCCCACCTTCGACGTCCGTCTGCTCCAGCCCGTC
ATCTTCTCCACATACGACGCTAAGCATTCGCCTTTGAAGAACGCGCTGCTCTCCGACGTC
TGCATCGGCACGTCGGCGGCGCCGACGTACCTCCCCGCGCACTGCTTCCGGACACACGAC
GGCGCCGGCGAAACGCGCGAGTACAACCTCATCGACGGCGGCGTCGCTGCCAACAATCCT
ACGATGGTAGCCATGACGATGATCACGGAGGAGATGATAGCAGAGGAGAAGGCACGGTTG
TTCTTGGCGAAGCCGCCGGAGGAGTGCGGGCGGTTCCTGCTGCTGTCCATCGGCACCGGA
TTGGCCTCCGACGAGGGGCTGTACACGGCGGAGAAGTGCTCCCGGTGGGGGACGCTCGGG
TGGCTGCGGCACAGGGGCATGGCGCCCATCATCGACATCTTCATGGCGGGGAGCTCCGAC
ATGGTCGACATCCACATCGGCGTCAAGTTCCAGCTGCTCCACATTGAGCGTAACTACCTC
CGCATCCAGGAATACCAGGACTACGACCCGCTCAAGGCCacggcggcggcggcgctggac
gaggcgacgccggagaacatgaggaacctcgtcggcgtcggcgagcgcatgctggagcag
caggttacgagggtcaacgtggagaccgggaggtacgagaaggtctccgacgaggggagc
AACGCCGACGCGCTCATCAGGATGGCGAGGCAGCTCTCGGAGGAGAGGACGGCGAGGCTG
CAGCGGCGGATGGGCGAAGTGACGGCGGCCAGTGCCTGTGCCACTGGGTTTTAG

CDS

1314 bp

>Os12t0551600-00
ATGCTTCGCTTCACCACTGCTCGTCTCCTCCGGCCTCGGTGCCGGCGTCTCTATCATGGC
TGCAGCGACGGCGCGGCGGCGTGCAGTGTCGTCGGCGAGAGGGTGACGGTGCTGACCATC
GATGGCGGCGGCATCCGGGGGATCATCCCGGGCAAGGTGCTCGAGTTCTTGGAGAACGAG
CTCCAGCAGCTGGATGGGCCAGAGGCGAGGCTGGCCGACTACTTCGACTACATCGCCGGG
ACGAGCACCGGCGGGCTGATCACCGCGATGCTGGCCGCGCCCGGCGCCGGCGGGGACGGA
CGGCGGCGGCCGCTGTTCGCCGCCAAGGAGATTTGTCCGTTCTACCAGGAGCACGGCCCG
CGCATCTTCCCCCAGAGGTGGTGCAAGCTCGCCTCCACTGTCGCCGCGGTGTGGGGGCCC
AAGTACAACGGTAGGTACCTCCGCAACATGGTCCGGGAGGTGCTCGGCGAAATGACGGTG
GGCGACACGCTCACCAATGTCGTCATCCCCACCTTCGACGTCCGTCTGCTCCAGCCCGTC
ATCTTCTCCACATACGACGCTAAGCATTCGCCTTTGAAGAACGCGCTGCTCTCCGACGTC
TGCATCGGCACGTCGGCGGCGCCGACGTACCTCCCCGCGCACTGCTTCCGGACACACGAC
GGCGCCGGCGAAACGCGCGAGTACAACCTCATCGACGGCGGCGTCGCTGCCAACAATCCT
ACGATGGTAGCCATGACGATGATCACGGAGGAGATGATAGCAGAGGAGAAGGCACGGTTG
TTCTTGGCGAAGCCGCCGGAGGAGTGCGGGCGGTTCCTGCTGCTGTCCATCGGCACCGGA
TTGGCCTCCGACGAGGGGCTGTACACGGCGGAGAAGTGCTCCCGGTGGGGGACGCTCGGG
TGGCTGCGGCACAGGGGCATGGCGCCCATCATCGACATCTTCATGGCGGGGAGCTCCGAC
ATGGTCGACATCCACATCGGCGTCAAGTTCCAGCTGCTCCACATTGAGCGTAACTACCTC
CGCATCCAGGAATACCAGGACTACGACCCGCTCAAGGCCacggcggcggcggcgctggac
gaggcgacgccggagaacatgaggaacctcgtcggcgtcggcgagcgcatgctggagcag
caggttacgagggtcaacgtggagaccgggaggtacgagaaggtctccgacgaggggagc
AACGCCGACGCGCTCATCAGGATGGCGAGGCAGCTCTCGGAGGAGAGGACGGCGAGGCTG
CAGCGGCGGATGGGCGAAGTGACGGCGGCCAGTGCCTGTGCCACTGGGTTTTAG

Protein

438 aa

>Os12t0551600-00
MLRFTTARLLRPRCRRLYHGCSDGAAACSVVGERVTVLTIDGGGIRGIIPGKVLEFLENE
LQQLDGPEARLADYFDYIAGTSTGGLITAMLAAPGAGGDGRRRPLFAAKEICPFYQEHGP
RIFPQRWCKLASTVAAVWGPKYNGRYLRNMVREVLGEMTVGDTLTNVVIPTFDVRLLQPV
IFSTYDAKHSPLKNALLSDVCIGTSAAPTYLPAHCFRTHDGAGETREYNLIDGGVAANNP
TMVAMTMITEEMIAEEKARLFLAKPPEECGRFLLLSIGTGLASDEGLYTAEKCSRWGTLG
WLRHRGMAPIIDIFMAGSSDMVDIHIGVKFQLLHIERNYLRIQEYQDYDPLKATAAAALD
EATPENMRNLVGVGERMLEQQVTRVNVETGRYEKVSDEGSNADALIRMARQLSEERTARL
QRRMGEVTAASACATGF*

CDS

chr12:22372090..22372647 (+ strand) : 558 bp

chr12:22372745..22372906 (+ strand) : 162 bp

chr12:22373023..22373616 (+ strand) : 594 bp

FASTA

>Os12t0551600-00 class=Sequence position=chr12:22372090..22373616 (+ strand)
ATGCTTCGCT TCACCACTGC TCGTCTCCTC CGGCCTCGGT GCCGGCGTCT CTATCATGGC TGCAGCGACG GCGCGGCGGC
GTGCAGTGTC GTCGGCGAGA GGGTGACGGT GCTGACCATC GATGGCGGCG GCATCCGGGG GATCATCCCG GGCAAGGTGC
TCGAGTTCTT GGAGAACGAG CTCCAGCAGC TGGATGGGCC AGAGGCGAGG CTGGCCGACT ACTTCGACTA CATCGCCGGG
ACGAGCACCG GCGGGCTGAT CACCGCGATG CTGGCCGCGC CCGGCGCCGG CGGGGACGGA CGGCGGCGGC CGCTGTTCGC
CGCCAAGGAG ATTTGTCCGT TCTACCAGGA GCACGGCCCG CGCATCTTCC CCCAGAGGTG GTGCAAGCTC GCCTCCACTG
TCGCCGCGGT GTGGGGGCCC AAGTACAACG GTAGGTACCT CCGCAACATG GTCCGGGAGG TGCTCGGCGA AATGACGGTG
GGCGACACGC TCACCAATGT CGTCATCCCC ACCTTCGACG TCCGTCTGCT CCAGCCCGTC ATCTTCTCCA CATACGACGT
ATGTGCGTGC GCCATTGATG TTTCATGTTT GGTTTGATAG CTGAACAGCT GAAGGAAAAC TGTTTCTGAA TTGGGGTGTG
TGTGTGTCTG TGCAGGCTAA GCATTCGCCT TTGAAGAACG CGCTGCTCTC CGACGTCTGC ATCGGCACGT CGGCGGCGCC
GACGTACCTC CCCGCGCACT GCTTCCGGAC ACACGACGGC GCCGGCGAAA CGCGCGAGTA CAACCTCATC GACGGCGGCG
TCGCTGCCAA CAATCCTGTA CAGTATTATT CCATCAGATT TGTAATTCAT ACTTCTTCCA TTCCAAAATA TGAGAAATTG
GTAGTGCTAG AATGTGTCTC ATTTAGTACT AGCTCCTTAT ATTCTTTTTT CAGACGATGG TAGCCATGAC GATGATCACG
GAGGAGATGA TAGCAGAGGA GAAGGCACGG TTGTTCTTGG CGAAGCCGCC GGAGGAGTGC GGGCGGTTCC TGCTGCTGTC
CATCGGCACC GGATTGGCCT CCGACGAGGG GCTGTACACG GCGGAGAAGT GCTCCCGGTG GGGGACGCTC GGGTGGCTGC
GGCACAGGGG CATGGCGCCC ATCATCGACA TCTTCATGGC GGGGAGCTCC GACATGGTCG ACATCCACAT CGGCGTCAAG
TTCCAGCTGC TCCACATTGA GCGTAACTAC CTCCGCATCC AGGAATACCA GGACTACGAC CCGCTCAAGG CCacggcggc
ggcggcgctg gacgaggcga cgccggagaa catgaggaac ctcgtcggcg tcggcgagcg catgctggag cagcaggtta
cgagggtcaa cgtggagacc gggaggtacg agaaggtctc cgacgagggg agcAACGCCG ACGCGCTCAT CAGGATGGCG
AGGCAGCTCT CGGAGGAGAG GACGGCGAGG CTGCAGCGGC GGATGGGCGA AGTGACGGCG GCCAGTGCCT GTGCCACTGG
GTTTTAG

Locus: Os12g0551600

Loading...

Locus: Os12g0551600

Loading...