Os12t0552300-01

Locus

Os12g0552300

Description

DYW motif-containing pentatricopeptide repeat protein, RNA editing of nad3 transcripts in mitochondria

RAP-DB Gene Symbol Synonym(s)

PPS1

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PPS1

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

PPR, OsPPS1

Oryzabase Gene Name Synonym(s)

Pentatricopeptide repeat (PPR) protein

Transcript Evidence

XM_015762859

Protein Evidence

A0A0P0YB55

Literature

PMID: 30019754

Note

Manual Curation

July 25, 2018

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Tetratricopeptide-like helical domain superfamily (IPR011990)

DYW domain (IPR032867)

Pentatricopeptide repeat (IPR002885)

Experimentally confirmed subcellular location

mitochondrion (GO:0005739)

Expression Databases

TENOR (Os12t0552300-00)

Others

Oryzabase (22509)

Oryzabase (22597)

Transcript

5974 bp

>Os12t0552300-01 DYW motif-containing pentatricopeptide repeat protein, RNA editing of nad3 transcripts in mitochondria
ATCAATCAGATGCTCAGACAACTCGAGGTTGTCTTTGAGACAAGCGCAGTCgggagaaaa
gtagctggttttctatacccatgcttttcaaagtattaaatggtattttttctatatttt
tttttataaaaaagttgtttttaaaaattatattaattaattttttaaatttaaaataat
taatactcaaataatcatgcatcaatagtttatcttgtttcttcttaatctttTTTTTTC
TTTTTGCTCCTCTTAAACACACCCGAAGAATGTCACCTAGAAAAGGAAAAAAGAAAAACA
AAGTTAGTATGATCTCAGCCGTCGGTGGGCTAAAGAGGCATCTCCGAATCTCAACCATTG
GATCTTCATCACTCTCAGTTCGGAGTTTCTAACAcctccctcggccctcccactcccaca
acctccgccgcggcggcgcaagcaggcgaccttgcctccgccggcgtccggcgacctcgc
cgccgccgccgccaccaccgcctcctaccttctacgcATGCCATTACTCCCTCCTGCAAT
CGTAGCACCGTGAAGCACCATCTGCCCTGGAGATCCGCAGGCTGAGATGCCATCCACTGT
GTCGCGCCCCAGGTGTTCGACGGAATGACGCGCCGGGGAGCGGCCTCCCTCGGGAGGACG
CTCGCCGGGTTCCTGGCGCATGAAGATCCAGCCAAGGTCCTCTCCCTATTTGCGGACAAG
GCCAGGCAGCATGGGGGTCTTGGCCCCCTCGACTTCGCGTGCGCCCTGCGCGCGTGCAGG
GGGAATGGCAGGCGTTGGCAGGTCGTTCCGGAGATACACGCGAAGGCTGTCACGCGTGGT
CTTGGGAAATACAGGATCGTCGGCAACCTTCTGATTGACCTGTACTCCAAGAACGGGCTT
GTTCTGCCTGCGAGGCGGGTGTTTGAGGAGCTTTCTGCCAGGGACAATGTCTCCTGGGTG
GCAATGCTGTCAGGGTATGCGCAGAATGGCCTTGGGGAGGAAGCTCTCGGGCTGTATCGC
CAGATGCATCGAGCTGGGGTTGTTCCTACACCTTATGTTCTGTCTAGCGTCCTGAGTTCG
TGCACTAAAGCGGAGCTCTTTGCGCAAGGACGGTTGATTCATGCCCAAGGTTACAAGCAC
GGATTCTGCTCTGAAATCTTTGTGGGGAATGCTGTTATCACGCTGTACTTGCGGTGCGGA
TCATTCAGATTGGCAGAGAGAGTATTTTGCGACATGCCACACCGTGACACAGTAACATTC
AATACGTTGATCTCAGGACATGCTCAGTGTGGACATGGGGAGCATGCTTTAGAGATATTT
GAGGAGATGCAGTTCTCAGGGTTAAGCCCTGATTGTGTGACCATTTCTAGTCTGCTTGCA
GCTTGTGCGTCGCTTGGTGATCTTCAAAAGGGGACGCAACTCCATTCCTATCTGTTTAAA
GCAGGCATCTCTTCGGATTACATAATGGAAGGTTCACTCCTTGACCTCTATGTGAAATGT
GGTGATGTTGAAACTGCCCTTGTGATCTTCAATTCGAGTGATAGGACTAACGTAGTACTC
TGGAACCTGATGCTTGTGGCATTTGGGCAGATCAATGATCTAGCAAAGTCTTTTGAGCTA
TTCTGTCAAATGCAGGCTGCAGGTATACGCCCTAACCAATTCACGTACCCATGCATTTTA
AGGACTTGCACTTGCACTAGAGAAATTGACCTTGGAGAGCAGATCCATTCATTAAGTGTA
AAAACTGGCTTCGAGTCTGATATGTATGTTAGTGGTGTATTGATAGATATGTATTCCAAA
TATGGGTGGCTTGAAAAGGCAAGACGTGTTCTTGAAATGCTTAAAGAGAAAGACGTGGTT
TCCTGGACTTCCATGATTGCTGGATATGTGCAACATGAGTGTTGTAAGGACGCTCTTGCA
GCTTTTAAAGAGATGCAGAAATGTGGAATTTGGCCAGATAACATAGGACTAGCAAGTGCT
ATAAGTGGCTGCGCTGGAATCAATGCAATGAGGCAAGGCTTGCAGATTCATGCTCGGATT
TATGTGTCTGGTTATTCAGGAGATGTTTCAATTTGGAATGCATTGGTAAACCTTTATGCA
CGATGCGGAAGAATCAGAGAAGCTTTCTCTTCATTCGAGGAAATTGAACATAAAGATGAG
ATAACATGGAACGGCCTGGTATCTGGTTTTGCACAAAGTGGCCTACATGAAGAAGCTCTC
AAGGTATTTATGCGTATGGATCAATCAGGTGTCAAGCATAATGTGTTCACATTTGTATCA
GCTCTTAGTGCTTCAGCTAACCTTGCAGAAATAAAACAAGGAAAACAAATACATGCCAGA
GTTATTAAAACAGGTCATTCCTTCGAAACTGAAGTTGGAAATGCTCTGATTTCCTTGTAC
GGGAAGTGTGGTAGCTTTGAGGATGCCAAGATGGAATTTTCTGAAATGTCTGAGAGAAAT
GAGGTGTCATGGAATACTATTATCACAAGCTGTTCACAGCATGGACGTGGCTTGGAGGCT
TTGGATTTATTTGATCAAATGAAGAAAGAAGGTATTAAACCAAATGATGTTACATTCATA
GGTGTTTTAGCTGCTTGCAGTCATGTGGGATTGGTGGAGGAAGGCCTTAGTTACTTCAAA
TCAATGTCTGATGAGTATGGAATTCGTCCAAGGCCTGATCATTATGCTTGTGTTATCGAT
ATCTTTGGACGAGCTGGGCAACTTGACCGTGCAAAGAAATTTATTGAGGAAATGCCAATT
GCTGCTGATGCTATGGTTTGGAGAACCCTTCTCAGCGCCTGTAAAGTACACAAGAACATA
GAAGTTGGAGAGTTTGCAGCCAAACATCTATTGGAATTGGAGCCTCATGATTCTGCATCA
TATGTTCTTCTCTCAAATGCATATGCTGTTACCGAGAAGTGGGCCAATAGGGATCAGGTC
AGAAAGATGATGAGAGACAGAGGAGTCAGAAAGGAACCAGGCCGGAGCTGGATTGAAGTA
AAGAATGTGGTTCATGCATTCTTTGTTGGTGACAGATTACACCCCTTGGCTGAGCAGATA
TACAATTTTTTGGCTGTTATAAATGATAGGGTAGCCAAAGTAGGATACAAGCAAGAGAAA
TATCATCTCTTCCATGATAAAGAGCAAGAAGGGAGAGATCCTACTGATCTTGTGCACAGC
GAGAAGTTAGCTGTGACTTTTGGGTTGATGAGTTTGCCTCCCTGTATGCCCCTTCGAGTC
ATTAAAAATCTTCGTGTATGTAACGATTGCCACACTTGGATGAAATTTACTTCCGACGTC
ATGGGAAGACAAATTGTATTACGAGATGTCTACAGATTTCACCATTTTAACAATGGAAGC
TGTTCATGCGGAGACTTCTGGTGAAGTGCTTTGAAGTGAAAACCTACAATTACCAGCCCC
AAGTAACCCATTTATACTCATTACGGTGCCACTTCAAGCAGTTTATGTGGGACATACACC
TCTTTCTTTCTAGTGCTACATGCACACATCTAAAACTGGAATTCAGCATGATCAGACAGA
CAGGCAATATAATGTACAGTTATTCTCCCCTGAGAAACGATCTTTGGATTAAGAATTCCT
GTTCTGCTATTTTTCTTTTATCATGTTGGTATTGTCATCTTAAGTATTTTTATCTGAATG
TGTGGAGAAATATACTTCATTGTATGCCAACTTTCTTCATCAGAAGAGAACAAATGGTCA
AGTAGGGTCTATTATCAGTCACTGGTAGGCCTAAAAAAATCAATCAAGAGTTCGGTCAGA
CACTCAGACTCCGTTGATACAATTACATGTTCATGTAAAATCCTAATTGCTGAGATTACC
CAACTCTGACGATGGATTTCCCCTAATCTCAACATTGCTTTGGGATTCAATAATTGAGAC
AGATTGAGAAAACTGAAAGAAAGGAGCGAGCAGGAGGGATGAAAGGAAAACAATTGGAAA
CCCCAATTAGTCATCTGAAATCTGGAGCACGTAGAAACATTCTCAAGCCTGCTTCTGCTG
CTGCAGCTGTGATGGAGCTGACATGCCCAAACCAAAAAATGGCTTATCAGCAGGGTATTC
GATGCCTCCTTGAAAGAGAAGCTGGTGCATATTTTGTGTGCTTTCAGAGGAATAGTCGGG
AGTGTAAGCGTAATCGCCGAGGAGTTTTATGTGGATTTTCTGATGGACGGCTTCACGATG
CGCGCGGCAGTTATACATTTTCATGTCGTAGAGCTGCTTGTGGGGTTCGGATCGGAGTTC
AGGGGCTGGTGTTCGGCATCGTATTGTGCATGCCCACTAGCAGCTTTCTACATGTCCGGG
CTGCCTGTACATCGTCGGCAGCGGTGGTCGGTGGAGATGATCCGAGCAAAGCAAACCTGA
AGCCTCTGCGCTGGACGTCCTCTACTCCCTAGCTCTGGCCCAGGATGTCGGCTGCCACGC
GATCCGCTGCTGGGCTACCTGGAGGAAGGAAACCAGGGTAAGACGTGAGAAGGAAGGAAC
CTGATCGTCGAGCTGATGGAGTCGTCTAAGCCACTGGACAGGTACGTGTCCGGGGTAAAG
GTTTATGGACGAGCTCATCCATGAGGTTGGACTGCGGGAACATCATAGGTTGATGAAACA
AACAGCTGCTGACTGGTGGCGACATCATCCACAAACTTGTGCAGACGCTGAGCCCCAGAT
CAAGCCCGTATGACAGGGAGATCCATCTGGAGGAGCTGCCACCACGAGGGCTGCAGTGCA
TAGCTTCCCTTCTTGTCACCTTCCAGGAGTACTCTGGGATGGAGACCTACGAGCGAGACT
GGCGACCAGGGTTAAACTTTCGGTTTAGCCGATTTGATCGTACGTCACCGAAATACTAAA
ATTTTGAacaaaatttagttgagtttgaacaaatattaccaaagttcacgaaaaatttaa
aaaactgaaaaattgcggctgaaataatatcgtatgaggggtccgaaatttccaaCCCTG
CTGGCGACTCGATCGCCATGGCACACTCGAGGTTGGCCAGGTTGATGATGCGTAAGCAGA
GAAAATTATAGATATTCATGTGGATACGTCTTCCTTTTTGGCTTGCGGAAGCAGAGAAAA
TTTCATGAGGGGCCGAACAAATTTGGTCTGGCACCTGTTGATCATCTTTGGTGACTTAGG
TTCTGATGGAAACGACAGCTCCATCAGAGAGTTGACAGGGCAAATGCTGCAGGATATGGT
ATAATATCTTCCAGGAGGGAAATCTATGCCATGATTATCTTGGATCTAGATCAGAAGTAT
TCTTACCGCTCCATACTCGTTTATGTGCTTCTTCTTTATGACAAAACCAACGATGATCAA
CTTCTCAAGCATCTGAAGCGAGAAATTATCCACGGCATGCAACAGGTGCTCGAAGAAACA
CTTCCTACAAGGAAAGAAATATAAGCAGCAGCAACAGAAGCGAGTAACACCAAGATTTCG
TCACCAGATACTGACGTAGAAGCACAACAATCCGGCCGGCCTCAATTCACAAGGCACTGA
GCAGCAGAATAACAACTCTGCTTCTTCTAGGTCAGCGAGGCTATGACGAAGCTGCAGGAA
GCCTTGGTATCTCTCTGTGAGACAGCACGCGACACTTGGATCAGTGCAGTCGTGCAGAGA
TCCAGAAATGGGTCGTGAGATGGATGAGGTTGCTGCTATGTTTTGTTCAAAGCAAGGGAA
ACCTGTCGGGAATTATGCTTCGCTGGTGAAGGAAGCACGGGAGCGTCTGGTGGTGAAGAA
GAAAGAACAAGAATCGGCTACCAACGTATCCGCTACCTCTTCTTCGATGGCTACCTGAAT
GGGCAATGTTGTGAATATAATCTCATGTATATTCTTGAGCACTTTATTtaggctgtgttt
agttcgtgtgccaaatcttttttaagtatacagaaacatatttaaagtattaaatgtaga
ctaataacaaaacaaattataaattccgcatata

CDS

2760 bp

>Os12t0552300-01 DYW motif-containing pentatricopeptide repeat protein, RNA editing of nad3 transcripts in mitochondria
ATGACGCGCCGGGGAGCGGCCTCCCTCGGGAGGACGCTCGCCGGGTTCCTGGCGCATGAA
GATCCAGCCAAGGTCCTCTCCCTATTTGCGGACAAGGCCAGGCAGCATGGGGGTCTTGGC
CCCCTCGACTTCGCGTGCGCCCTGCGCGCGTGCAGGGGGAATGGCAGGCGTTGGCAGGTC
GTTCCGGAGATACACGCGAAGGCTGTCACGCGTGGTCTTGGGAAATACAGGATCGTCGGC
AACCTTCTGATTGACCTGTACTCCAAGAACGGGCTTGTTCTGCCTGCGAGGCGGGTGTTT
GAGGAGCTTTCTGCCAGGGACAATGTCTCCTGGGTGGCAATGCTGTCAGGGTATGCGCAG
AATGGCCTTGGGGAGGAAGCTCTCGGGCTGTATCGCCAGATGCATCGAGCTGGGGTTGTT
CCTACACCTTATGTTCTGTCTAGCGTCCTGAGTTCGTGCACTAAAGCGGAGCTCTTTGCG
CAAGGACGGTTGATTCATGCCCAAGGTTACAAGCACGGATTCTGCTCTGAAATCTTTGTG
GGGAATGCTGTTATCACGCTGTACTTGCGGTGCGGATCATTCAGATTGGCAGAGAGAGTA
TTTTGCGACATGCCACACCGTGACACAGTAACATTCAATACGTTGATCTCAGGACATGCT
CAGTGTGGACATGGGGAGCATGCTTTAGAGATATTTGAGGAGATGCAGTTCTCAGGGTTA
AGCCCTGATTGTGTGACCATTTCTAGTCTGCTTGCAGCTTGTGCGTCGCTTGGTGATCTT
CAAAAGGGGACGCAACTCCATTCCTATCTGTTTAAAGCAGGCATCTCTTCGGATTACATA
ATGGAAGGTTCACTCCTTGACCTCTATGTGAAATGTGGTGATGTTGAAACTGCCCTTGTG
ATCTTCAATTCGAGTGATAGGACTAACGTAGTACTCTGGAACCTGATGCTTGTGGCATTT
GGGCAGATCAATGATCTAGCAAAGTCTTTTGAGCTATTCTGTCAAATGCAGGCTGCAGGT
ATACGCCCTAACCAATTCACGTACCCATGCATTTTAAGGACTTGCACTTGCACTAGAGAA
ATTGACCTTGGAGAGCAGATCCATTCATTAAGTGTAAAAACTGGCTTCGAGTCTGATATG
TATGTTAGTGGTGTATTGATAGATATGTATTCCAAATATGGGTGGCTTGAAAAGGCAAGA
CGTGTTCTTGAAATGCTTAAAGAGAAAGACGTGGTTTCCTGGACTTCCATGATTGCTGGA
TATGTGCAACATGAGTGTTGTAAGGACGCTCTTGCAGCTTTTAAAGAGATGCAGAAATGT
GGAATTTGGCCAGATAACATAGGACTAGCAAGTGCTATAAGTGGCTGCGCTGGAATCAAT
GCAATGAGGCAAGGCTTGCAGATTCATGCTCGGATTTATGTGTCTGGTTATTCAGGAGAT
GTTTCAATTTGGAATGCATTGGTAAACCTTTATGCACGATGCGGAAGAATCAGAGAAGCT
TTCTCTTCATTCGAGGAAATTGAACATAAAGATGAGATAACATGGAACGGCCTGGTATCT
GGTTTTGCACAAAGTGGCCTACATGAAGAAGCTCTCAAGGTATTTATGCGTATGGATCAA
TCAGGTGTCAAGCATAATGTGTTCACATTTGTATCAGCTCTTAGTGCTTCAGCTAACCTT
GCAGAAATAAAACAAGGAAAACAAATACATGCCAGAGTTATTAAAACAGGTCATTCCTTC
GAAACTGAAGTTGGAAATGCTCTGATTTCCTTGTACGGGAAGTGTGGTAGCTTTGAGGAT
GCCAAGATGGAATTTTCTGAAATGTCTGAGAGAAATGAGGTGTCATGGAATACTATTATC
ACAAGCTGTTCACAGCATGGACGTGGCTTGGAGGCTTTGGATTTATTTGATCAAATGAAG
AAAGAAGGTATTAAACCAAATGATGTTACATTCATAGGTGTTTTAGCTGCTTGCAGTCAT
GTGGGATTGGTGGAGGAAGGCCTTAGTTACTTCAAATCAATGTCTGATGAGTATGGAATT
CGTCCAAGGCCTGATCATTATGCTTGTGTTATCGATATCTTTGGACGAGCTGGGCAACTT
GACCGTGCAAAGAAATTTATTGAGGAAATGCCAATTGCTGCTGATGCTATGGTTTGGAGA
ACCCTTCTCAGCGCCTGTAAAGTACACAAGAACATAGAAGTTGGAGAGTTTGCAGCCAAA
CATCTATTGGAATTGGAGCCTCATGATTCTGCATCATATGTTCTTCTCTCAAATGCATAT
GCTGTTACCGAGAAGTGGGCCAATAGGGATCAGGTCAGAAAGATGATGAGAGACAGAGGA
GTCAGAAAGGAACCAGGCCGGAGCTGGATTGAAGTAAAGAATGTGGTTCATGCATTCTTT
GTTGGTGACAGATTACACCCCTTGGCTGAGCAGATATACAATTTTTTGGCTGTTATAAAT
GATAGGGTAGCCAAAGTAGGATACAAGCAAGAGAAATATCATCTCTTCCATGATAAAGAG
CAAGAAGGGAGAGATCCTACTGATCTTGTGCACAGCGAGAAGTTAGCTGTGACTTTTGGG
TTGATGAGTTTGCCTCCCTGTATGCCCCTTCGAGTCATTAAAAATCTTCGTGTATGTAAC
GATTGCCACACTTGGATGAAATTTACTTCCGACGTCATGGGAAGACAAATTGTATTACGA
GATGTCTACAGATTTCACCATTTTAACAATGGAAGCTGTTCATGCGGAGACTTCTGGTGA

Protein

920 aa

>Os12t0552300-01 DYW motif-containing pentatricopeptide repeat protein, RNA editing of nad3 transcripts in mitochondria
MTRRGAASLGRTLAGFLAHEDPAKVLSLFADKARQHGGLGPLDFACALRACRGNGRRWQV
VPEIHAKAVTRGLGKYRIVGNLLIDLYSKNGLVLPARRVFEELSARDNVSWVAMLSGYAQ
NGLGEEALGLYRQMHRAGVVPTPYVLSSVLSSCTKAELFAQGRLIHAQGYKHGFCSEIFV
GNAVITLYLRCGSFRLAERVFCDMPHRDTVTFNTLISGHAQCGHGEHALEIFEEMQFSGL
SPDCVTISSLLAACASLGDLQKGTQLHSYLFKAGISSDYIMEGSLLDLYVKCGDVETALV
IFNSSDRTNVVLWNLMLVAFGQINDLAKSFELFCQMQAAGIRPNQFTYPCILRTCTCTRE
IDLGEQIHSLSVKTGFESDMYVSGVLIDMYSKYGWLEKARRVLEMLKEKDVVSWTSMIAG
YVQHECCKDALAAFKEMQKCGIWPDNIGLASAISGCAGINAMRQGLQIHARIYVSGYSGD
VSIWNALVNLYARCGRIREAFSSFEEIEHKDEITWNGLVSGFAQSGLHEEALKVFMRMDQ
SGVKHNVFTFVSALSASANLAEIKQGKQIHARVIKTGHSFETEVGNALISLYGKCGSFED
AKMEFSEMSERNEVSWNTIITSCSQHGRGLEALDLFDQMKKEGIKPNDVTFIGVLAACSH
VGLVEEGLSYFKSMSDEYGIRPRPDHYACVIDIFGRAGQLDRAKKFIEEMPIAADAMVWR
TLLSACKVHKNIEVGEFAAKHLLELEPHDSASYVLLSNAYAVTEKWANRDQVRKMMRDRG
VRKEPGRSWIEVKNVVHAFFVGDRLHPLAEQIYNFLAVINDRVAKVGYKQEKYHLFHDKE
QEGRDPTDLVHSEKLAVTFGLMSLPPCMPLRVIKNLRVCNDCHTWMKFTSDVMGRQIVLR
DVYRFHHFNNGSCSCGDFW*

5'UTR

chr12:22427186..22427809 (- strand) : 624 bp

CDS

chr12:22424426..22427185 (- strand) : 2760 bp

3'UTR

chr12:22424149..22424425 (- strand) : 277 bp

chr12:22423826..22424062 (- strand) : 237 bp

chr12:22423403..22423577 (- strand) : 175 bp

chr12:22421748..22422098 (- strand) : 351 bp

chr12:22420706..22421666 (- strand) : 961 bp

chr12:22419950..22420538 (- strand) : 589 bp

FASTA

>Os12t0552300-01 class=Sequence position=chr12:22419950..22427809 (- strand)
ATCAATCAGA TGCTCAGACA ACTCGAGGTT GTCTTTGAGA CAAGCGCAGT Cgggagaaaa gtagctggtt ttctataccc
atgcttttca aagtattaaa tggtattttt tctatatttt tttttataaa aaagttgttt ttaaaaatta tattaattaa
ttttttaaat ttaaaataat taatactcaa ataatcatgc atcaatagtt tatcttgttt cttcttaatc tttTTTTTTC
TTTTTGCTCC TCTTAAACAC ACCCGAAGAA TGTCACCTAG AAAAGGAAAA AAGAAAAACA AAGTTAGTAT GATCTCAGCC
GTCGGTGGGC TAAAGAGGCA TCTCCGAATC TCAACCATTG GATCTTCATC ACTCTCAGTT CGGAGTTTCT AACAcctccc
tcggccctcc cactcccaca acctccgccg cggcggcgca agcaggcgac cttgcctccg ccggcgtccg gcgacctcgc
cgccgccgcc gccaccaccg cctcctacct tctacgcATG CCATTACTCC CTCCTGCAAT CGTAGCACCG TGAAGCACCA
TCTGCCCTGG AGATCCGCAG GCTGAGATGC CATCCACTGT GTCGCGCCCC AGGTGTTCGA CGGAATGACG CGCCGGGGAG
CGGCCTCCCT CGGGAGGACG CTCGCCGGGT TCCTGGCGCA TGAAGATCCA GCCAAGGTCC TCTCCCTATT TGCGGACAAG
GCCAGGCAGC ATGGGGGTCT TGGCCCCCTC GACTTCGCGT GCGCCCTGCG CGCGTGCAGG GGGAATGGCA GGCGTTGGCA
GGTCGTTCCG GAGATACACG CGAAGGCTGT CACGCGTGGT CTTGGGAAAT ACAGGATCGT CGGCAACCTT CTGATTGACC
TGTACTCCAA GAACGGGCTT GTTCTGCCTG CGAGGCGGGT GTTTGAGGAG CTTTCTGCCA GGGACAATGT CTCCTGGGTG
GCAATGCTGT CAGGGTATGC GCAGAATGGC CTTGGGGAGG AAGCTCTCGG GCTGTATCGC CAGATGCATC GAGCTGGGGT
TGTTCCTACA CCTTATGTTC TGTCTAGCGT CCTGAGTTCG TGCACTAAAG CGGAGCTCTT TGCGCAAGGA CGGTTGATTC
ATGCCCAAGG TTACAAGCAC GGATTCTGCT CTGAAATCTT TGTGGGGAAT GCTGTTATCA CGCTGTACTT GCGGTGCGGA
TCATTCAGAT TGGCAGAGAG AGTATTTTGC GACATGCCAC ACCGTGACAC AGTAACATTC AATACGTTGA TCTCAGGACA
TGCTCAGTGT GGACATGGGG AGCATGCTTT AGAGATATTT GAGGAGATGC AGTTCTCAGG GTTAAGCCCT GATTGTGTGA
CCATTTCTAG TCTGCTTGCA GCTTGTGCGT CGCTTGGTGA TCTTCAAAAG GGGACGCAAC TCCATTCCTA TCTGTTTAAA
GCAGGCATCT CTTCGGATTA CATAATGGAA GGTTCACTCC TTGACCTCTA TGTGAAATGT GGTGATGTTG AAACTGCCCT
TGTGATCTTC AATTCGAGTG ATAGGACTAA CGTAGTACTC TGGAACCTGA TGCTTGTGGC ATTTGGGCAG ATCAATGATC
TAGCAAAGTC TTTTGAGCTA TTCTGTCAAA TGCAGGCTGC AGGTATACGC CCTAACCAAT TCACGTACCC ATGCATTTTA
AGGACTTGCA CTTGCACTAG AGAAATTGAC CTTGGAGAGC AGATCCATTC ATTAAGTGTA AAAACTGGCT TCGAGTCTGA
TATGTATGTT AGTGGTGTAT TGATAGATAT GTATTCCAAA TATGGGTGGC TTGAAAAGGC AAGACGTGTT CTTGAAATGC
TTAAAGAGAA AGACGTGGTT TCCTGGACTT CCATGATTGC TGGATATGTG CAACATGAGT GTTGTAAGGA CGCTCTTGCA
GCTTTTAAAG AGATGCAGAA ATGTGGAATT TGGCCAGATA ACATAGGACT AGCAAGTGCT ATAAGTGGCT GCGCTGGAAT
CAATGCAATG AGGCAAGGCT TGCAGATTCA TGCTCGGATT TATGTGTCTG GTTATTCAGG AGATGTTTCA ATTTGGAATG
CATTGGTAAA CCTTTATGCA CGATGCGGAA GAATCAGAGA AGCTTTCTCT TCATTCGAGG AAATTGAACA TAAAGATGAG
ATAACATGGA ACGGCCTGGT ATCTGGTTTT GCACAAAGTG GCCTACATGA AGAAGCTCTC AAGGTATTTA TGCGTATGGA
TCAATCAGGT GTCAAGCATA ATGTGTTCAC ATTTGTATCA GCTCTTAGTG CTTCAGCTAA CCTTGCAGAA ATAAAACAAG
GAAAACAAAT ACATGCCAGA GTTATTAAAA CAGGTCATTC CTTCGAAACT GAAGTTGGAA ATGCTCTGAT TTCCTTGTAC
GGGAAGTGTG GTAGCTTTGA GGATGCCAAG ATGGAATTTT CTGAAATGTC TGAGAGAAAT GAGGTGTCAT GGAATACTAT
TATCACAAGC TGTTCACAGC ATGGACGTGG CTTGGAGGCT TTGGATTTAT TTGATCAAAT GAAGAAAGAA GGTATTAAAC
CAAATGATGT TACATTCATA GGTGTTTTAG CTGCTTGCAG TCATGTGGGA TTGGTGGAGG AAGGCCTTAG TTACTTCAAA
TCAATGTCTG ATGAGTATGG AATTCGTCCA AGGCCTGATC ATTATGCTTG TGTTATCGAT ATCTTTGGAC GAGCTGGGCA
ACTTGACCGT GCAAAGAAAT TTATTGAGGA AATGCCAATT GCTGCTGATG CTATGGTTTG GAGAACCCTT CTCAGCGCCT
GTAAAGTACA CAAGAACATA GAAGTTGGAG AGTTTGCAGC CAAACATCTA TTGGAATTGG AGCCTCATGA TTCTGCATCA
TATGTTCTTC TCTCAAATGC ATATGCTGTT ACCGAGAAGT GGGCCAATAG GGATCAGGTC AGAAAGATGA TGAGAGACAG
AGGAGTCAGA AAGGAACCAG GCCGGAGCTG GATTGAAGTA AAGAATGTGG TTCATGCATT CTTTGTTGGT GACAGATTAC
ACCCCTTGGC TGAGCAGATA TACAATTTTT TGGCTGTTAT AAATGATAGG GTAGCCAAAG TAGGATACAA GCAAGAGAAA
TATCATCTCT TCCATGATAA AGAGCAAGAA GGGAGAGATC CTACTGATCT TGTGCACAGC GAGAAGTTAG CTGTGACTTT
TGGGTTGATG AGTTTGCCTC CCTGTATGCC CCTTCGAGTC ATTAAAAATC TTCGTGTATG TAACGATTGC CACACTTGGA
TGAAATTTAC TTCCGACGTC ATGGGAAGAC AAATTGTATT ACGAGATGTC TACAGATTTC ACCATTTTAA CAATGGAAGC
TGTTCATGCG GAGACTTCTG GTGAAGTGCT TTGAAGTGAA AACCTACAAT TACCAGCCCC AAGTAACCCA TTTATACTCA
TTACGGTGCC ACTTCAAGCA GTTTATGTGG GACATACACC TCTTTCTTTC TAGTGCTACA TGCACACATC TAAAACTGGA
ATTCAGCATG ATCAGACAGA CAGGCAATAT AATGTACAGT TATTCTCCCC TGAGAAACGA TCTTTGGATT AAGAATTCCT
GTTCTGCTAT TTTTCTTTTA TCATGTTGGT ATTGTCATCT TAAGTATTTT TATCTGAATG TGTATGTATT ACATTCTCTC
TTCTGACAAT TATCTGAATG TATATGTATT ACATTCTCTT TTCTGACAAC CATCTCGCTT GTTTCAGGTG GAGAAATATA
CTTCATTGTA TGCCAACTTT CTTCATCAGA AGAGAACAAA TGGTCAAGTA GGGTCTATTA TCAGTCACTG GTAGGCCTAA
AAAAATCAAT CAAGAGTTCG GTCAGACACT CAGACTCCGT TGATACAATT ACATGTTCAT GTAAAATCCT AATTGCTGAG
ATTACCCAAC TCTGACGATG GATTTCCCCT AATCTCAACA TTGCTTTGGG ATTCAATAAT TGAGGTCTGA CTATGTCCTC
CATAGTAGTA TCAGTAAATT ATTTAACTCA TTTGATAATG TATTAGGACT GGCAAATACA TGTTGTACTT GTACCTAGAA
ACCTTATTCC TTGTGTATAT TTGTGAAATA TGACAAATCA CGGCATGTTG TACAGCTTCT ATGTTAGCTT CTTTCATGTG
CATGCCATGG TGATCATAGG CATATACAAC TGAATGAACT GAACCTTGTC TTATGCTTGC TTTACTTCGC AGACAGATTG
AGAAAACTGA AAGAAAGGAG CGAGCAGGAG GGATGAAAGG AAAACAATTG GAAACCCCAA TTAGTCATCT GAAATCTGGA
GCACGTAGAA ACATTCTCAA GCCTGCTTCT GCTGCTGCAG CTGTGATGGA GCTGACATGC CCAAACCAAA AAATGGCTTA
TCAGCAGGTA CGTTGATGGT CGTGAGGTGG AAACCTGGTA AGGGCTTATG AATTACTCCC TCCGTTTCAG GTTATAAGAC
GTTTTGACtt tgatcaaagt caaactcctt taactttgac caagtttata gagaaaagta gtgacatttt taacccaaga
caaatttatt atgaaaatat aatcaattat tgatttgatg aaactaattt agtattataa atattattat atttgtctat
aaacttagtc aaacttaaaa cagtttgact ttgaCCAAAG TCAAAACGTC TTATAACCTG AAACAGAGGG AGTATTATGT
GGTACATAGA TTGTGCTGTG CAGACAATAA GAAACTTGTC CCATATGTAA GACATGCCGA AATTAGTTAG AAGGGAAGAA
ATTCACAGCC AATGTCAAAT GGCTCTTATC AGACCTGTTT ATGAGATTTA ATGGGCCTAA TTAGGACCAC ATCTATAGTT
AAAAATTCTG AAAAAAAGGT ATATTTTATA TGTTACGCAA GCAGATGTAA ATGACCCAGT GGGCCAATAC TAAACGAGCA
AAGATGATAA CCCATTGCCA ATGTGATAAT GGGCAAAACG TAGGCAAAAG TAGTGGCCCA CTCCACTGCC AATGCACAAT
GAGTGAAAAA TTAAGATCAC TGCCATCTGC CAATGGCCCA ATCGAAAGAT AAACCCTCCT GTGGGGATTG TTTTTTCATA
GGAGAGTTTA GGATATGGCA TGGGGAGTCA ACTCTCATAC GGACATTCTT AGGTCTCTGG TGACAAACTC CACTGCTTGA
GTGCTTGGTT CTAGGTGTTG GATTGTTAAT TTATTTATTA TTGACGAGAA AACCAAATAG AATATGATTT TAACACTGTA
CTGAGTCAAA CGGCTATAAg ggcctgtttg ggagagcttt agattctgag aagcagctgc ttggtagcca gcttctgaga
atctagaaaa gctctgaaac tcagtttctt cagcttctgg cttcttagtt catttttcag aatctgtaac tacagattct
tagaagctgt ggactgtttg gggcagcttc tagcagaagc agcttttggg aaaagctaca gctgagataa gctcctccaa
acagggccTA AGAAGCTTGT GCTAGTTCAA TGCTATTGCA AGGCTATGTG CTAGTTTCTC TAGAAAATTA TAGAGTGCTT
CCATCTTTCA CGCACCTAAA TTTTCCGTTG TGTCTGTGTC CTTAAGTTCA TTTATGATGC TGTAAGAGGA ATATGAAGGC
GTTTTTTTTT TGGTTTGTTT TCATTGAACA GGGTATTCGA TGCCTCCTTG AAAGAGAAGC TGGTGCATAT TTTGTGTGCT
TTCAGAGGAA TAGTCGGGAG TGTAAGCGTA ATCGCCGAGG AGTTTTATGT GGATTTTCTG ATGGACGGCT TCACGATGCG
CGCGGCAGTT ATACATTTTC ATGTCGTAGA GCTGCTTGTG GGGTTCGGAT CGGAGTTCAG GGGCTGGTGT TCGGCATCGT
ATTGTGCATG CCCACTAGCA GCTTTCTACA TGTCCGGGCT GCCTGTACAT CGTCGGCAGC GGTGGTCGGT GGAGATGATC
CGAGCAAAGC AAACCTGAAG CCTCTGCGCT GGACGTCCTC TACTCCCTAG CTCTGGCCCA GGGTATTCTC TTCTGTTACA
AGACCATCTT TTCTCGCGGA GAAGTTGATA GCGAAGCACT TATGTGTATA ACTGCCATTA CAGATGTCGG CTGCCACGCG
ATCCGCTGCT GGGCTACCTG GAGGAAGGAA ACCAGGGTAA GACGTGAGAA GGAAGGAACC TGATCGTCGA GCTGATGGAG
TCGTCTAAGC CACTGGACAG GTACGTGTCC GGGGTAAAGG TTTATGGACG AGCTCATCCA TGAGGTTGGA CTGCGGGAAC
ATCATAGGTT GATGAAACAA ACAGCTGCTG ACTGGTGGCG ACATCATCCA CAAACTTGTG CAGACGCTGA GCCCCAGATC
AAGCCCGTAT GACAGGGAGA TCCATCTGGA GGAGCTGCCA CCACGAGGGC TGCAGTGCAT AGCTTCCCTT CTTGTCACCT
TCCAGGAGTA CTCTGGGATG GAGACCTACG AGCGAGACTG GCGACCAGGG TTAAACTTTC GGTTTAGCCG ATTTGATCGT
ACGTCACCGA AATACTAAAA TTTTGAacaa aatttagttg agtttgaaca aatattacca aagttcacga aaaatttaaa
aaactgaaaa attgcggctg aaataatatc gtatgagggg tccgaaattt ccaaCCCTGC TGGCGACTCG ATCGCCATGG
CACACTCGAG GTTGGCCAGG TTGATGATGC GTAAGCAGAG AAAATTATAG ATATTCATGT GGATACGTCT TCCTTTTTGG
CTTGCGGAAG CAGAGAAAAT TTCATGAGGG GCCGAACAAA TTTGGTCTGG CACCTGTTGA TCATCTTTGG TGACTTAGGT
TCTGATGGAA ACGACAGCTC CATCAGAGAG TTGACAGGGC AAATGCTGCA GGATATGGTA TAATATCTTC CAGGAGGGAA
ATCTATGCCA TGATTATCTT GGATCTAGAT CAGAAGTATT CTTACCGCTC CATACTCGTT TATGTGCTTC TTCTTTATGA
CAAAACCAAC GATGATCAAC TTCTCAAGCA TCTGAAGCGA GAAATTATCC ACGGCATGCA ACAGGTAATC AAATAATCTT
ATAATAATCA GTACTAGTAT GAGTATCCAC TAAGCAAAAC AAAATGGCGC TTTCTTTACT AACTTCAGAT ATGCAAATAT
GTAATACGGG GTAATATATC CTTTGCTTTT GATTCCCTTA GCTGATATAT ATAATACCAT CAACTTTTCA GGTGCTCGAA
GAAACACTTC CTACAAGGAA AGAAATATAA GCAGCAGCAA CAGAAGCGAG TAACACCAAG ATTTCGTCAC CAGATACTGA
CGTAGAAGCA CAACAATCCG GCCGGCCTCA ATTCACAAGG CACTGAGCAG CAGAATAACA ACTCTGCTTC TTCTAGGTCA
GCGAGGCTAT GACGAAGCTG CAGGAAGCCT TGGTATCTCT CTGTGAGACA GCACGCGACA CTTGGATCAG TGCAGTCGTG
CAGAGATCCA GAAATGGGTC GTGAGATGGA TGAGGTTGCT GCTATGTTTT GTTCAAAGCA AGGGAAACCT GTCGGGAATT
ATGCTTCGCT GGTGAAGGAA GCACGGGAGC GTCTGGTGGT GAAGAAGAAA GAACAAGAAT CGGCTACCAA CGTATCCGCT
ACCTCTTCTT CGATGGCTAC CTGAATGGGC AATGTTGTGA ATATAATCTC ATGTATATTC TTGAGCACTT TATTtaggct
gtgtttagtt cgtgtgccaa atctttttta agtatacaga aacatattta aagtattaaa tgtagactaa taacaaaaca
aattataaat tccgcatata 

Locus: Os12g0552300

Loading...

Locus: Os12g0552300

Loading...