Os12t0555300-00

Locus

Os12g0555300

Description

Similar to Pathogenesis-related protein PR-10a.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

PR10

Oryzabase Gene Name Synonym(s)

pathogenesis-related gene 10

Transcript Evidence

ab initio prediction

Protein Evidence

Q9LKJ9 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: defense response (GO:0006952)

Biological Process: response to biotic stimulus (GO:0009607)

Functional domain (InterPro)

Bet v I allergen (IPR000916)

START-like domain (IPR023393)

Expression Databases

TENOR (Os12t0555300-00)

Others

Oryzabase (15201)

Transcript

408 bp

>Os12t0555300-00 Similar to Pathogenesis-related protein PR-10a.
ATGGACGCGTCCGCCATGCCCAAGGTCTGTGCCGGCTTCGTCGACGACATTGTGGTTGAG
GGGAATGGCGGTCCAGGCACCATCTACACCATGAAGCTTAACCCCGATGCGGGAGTCGGG
AATACATACAAGACCCGAGTGGCGGTGTGTGACAATGCAGCACGCGTGCTAAAGTCAGAG
GTGCTGGAGGCAGAAAGCAAGGTGGGCAAGCTCAAGTCGCACTCGACGGAGACGAAGCTG
GAGGGCACCGGCGATGGCTCCTGCGTGGCCAAGCTCAAGGTGGAGTACGAGCTCGCCGAC
GGCAGCTCGCTGTCGCCGGAGCAGGAGAAGACGATGGTCGACGGCTACTTCGGCATGCTC
AAGATGATGGAGGCGTACCTCGCCGCTCACCCTGCCGAATTCGCCTGA

CDS

408 bp

>Os12t0555300-00 Similar to Pathogenesis-related protein PR-10a.
ATGGACGCGTCCGCCATGCCCAAGGTCTGTGCCGGCTTCGTCGACGACATTGTGGTTGAG
GGGAATGGCGGTCCAGGCACCATCTACACCATGAAGCTTAACCCCGATGCGGGAGTCGGG
AATACATACAAGACCCGAGTGGCGGTGTGTGACAATGCAGCACGCGTGCTAAAGTCAGAG
GTGCTGGAGGCAGAAAGCAAGGTGGGCAAGCTCAAGTCGCACTCGACGGAGACGAAGCTG
GAGGGCACCGGCGATGGCTCCTGCGTGGCCAAGCTCAAGGTGGAGTACGAGCTCGCCGAC
GGCAGCTCGCTGTCGCCGGAGCAGGAGAAGACGATGGTCGACGGCTACTTCGGCATGCTC
AAGATGATGGAGGCGTACCTCGCCGCTCACCCTGCCGAATTCGCCTGA

Protein

136 aa

>Os12t0555300-00 Similar to Pathogenesis-related protein PR-10a.
MDASAMPKVCAGFVDDIVVEGNGGPGTIYTMKLNPDAGVGNTYKTRVAVCDNAARVLKSE
VLEAESKVGKLKSHSTETKLEGTGDGSCVAKLKVEYELADGSSLSPEQEKTMVDGYFGML
KMMEAYLAAHPAEFA*

CDS

chr12:22595531..22595636 (+ strand) : 106 bp

chr12:22596503..22596804 (+ strand) : 302 bp

FASTA

>Os12t0555300-00 class=Sequence position=chr12:22595531..22596804 (+ strand)
ATGGACGCGT CCGCCATGCC CAAGGTCTGT GCCGGCTTCG TCGACGACAT TGTGGTTGAG GGGAATGGCG GTCCAGGCAC
CATCTACACC ATGAAGCTTA ACCCCGGTCG GTTTCGAACA ATAGCATTGG CACATTTTCA CTTCGTACAC CTGTAATTTT
GGAAAAGAAA TTTTGGGAGG TGGGGGTGAG GAGCTTAATT TTCATCCTTT Aggctaagct cgggagtgag ggttgggaac
cttcactttc agcatgcaaa atgaagcggc agttagcgca tgactaatta agttttagct aaaataagca ttgaaataga
ttaatatgat tttctaaaac aactttcata tagatatttt tttgtaaaaa caaaatttag aagtttgata agcatacctg
cgaaaaacga ggtagaagtt tggaaggaaa gtttagaaca cagccTAGTT TTTTTTTTTT TTTGGATCTT TCTACTAACC
TAGCCTCATC TGTCACTCGG TATCTTGAGA TAAGTTGAGA TCTTAACTAA GATAgtgttt gggaagaagt gactaaagtt
tagtctctca cacaaaaatt ttaatccctc ctatagggac ttatgttctt gtgagaggga ctaaagttta gtccctcctt
cccaaacacc acctAATTAA GAGGGTTAAA ATTACAGCTG TGCAAGGCGA ATTGATTGGG TATGTATAAC AGAAAAtact
ccctccgttt caaaatgttt gacaccgctg attttttcgt atgtgtttga tcatttgtct tattcaaaaa atttaagtaa
ttatttatta ttttcgtatc atttgactca ttgttaaata tactttcatg tgcacatata gttttacata tttcacaatt
tttttttgaa taagacgaac ggtcaaacat gtgctaaaaa gtcaaaggtg tcaaatattt tgaaacggag ggagtaTTCC
TATTATATGC AGATGCGGGA GTCGGGAATA CATACAAGAC CCGAGTGGCG GTGTGTGACA ATGCAGCACG CGTGCTAAAG
TCAGAGGTGC TGGAGGCAGA AAGCAAGGTG GGCAAGCTCA AGTCGCACTC GACGGAGACG AAGCTGGAGG GCACCGGCGA
TGGCTCCTGC GTGGCCAAGC TCAAGGTGGA GTACGAGCTC GCCGACGGCA GCTCGCTGTC GCCGGAGCAG GAGAAGACGA
TGGTCGACGG CTACTTCGGC ATGCTCAAGA TGATGGAGGC GTACCTCGCC GCTCACCCTG CCGAATTCGC CTGA