Os12t0556100-01

Locus

Os12g0556100

Description

Similar to fiber protein Fb2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDi19-7

Oryzabase Gene Name Synonym(s)

drought-induced 19-7

Transcript Evidence

AK243257 (DDBJ, Best hit)

Protein Evidence

NP_001150479.1 (RefSeq)

Literature

Note

Manual Curation

Functional domain (InterPro)

Drought induced 19/ RING finger protein 114 (IPR008598)

Full-length cDNA

J100048N01 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0556100-01)

Others

Oryzabase (18582)

KEGG (Os12t0556100-01)

Transcript

1320 bp

>Os12t0556100-01 Similar to fiber protein Fb2.
GCCACACACTCTCCCTCTCCGTGTCGGTGTCTCATCTCTCTCTCTCTTCCCATCCGCCGC
CAAAACCCTAGCCCCCCCTAAACCCCGCCGCCCGATCGCCGCCGCCGCCGCCGCCCTCCC
GCTTTCGCGGCCTCCGGTTTGGGCGCCCCCCCCCCGCCCGGCCCAAGAACCGTGTGCCCC
CGCCGCCGCCGCCGCGATGGACATGGACTCGTGGGAGCGCCTCGCCGCGGACGCCAGGCT
GCAGGGTTCGTGCTTCGATGCGTTGATTGGGATGGAGGAGGCGGAGGGGAGCGAAGGCGA
GGAGGAGGCGGCGGAGGTGGCGTGCCCGTTCTGCGACGAGGAGTTCGACGGATTCGGGCT
TTGCTGCCACATCGAGGACGAACACCAGGCGGAGAACAGGGCCGGGGTGTGTCCAATTTG
CTACGATGCGGTTGGGATGGACTTGGTTAGTCACATCACTTCGGAACATCCCAGTTTCTT
CAAGGGCAAATGGAGAAATCGGCGAGTTTCACATGGATCACATTCTTCAACGCGTGCCAC
ATTAAAAAAGGACGCGGCATATCTGCAGTACCGTTATGGAGGATCCACACGTGCTGCTTC
ACACAACACAGATCCTGATCCTCTACTATCCTCTTTTGTTGGTAACTTCACCGACACAGA
TTTACCAAAAGATGTACAACAAGAGTTCCGAGATGAAACGGATGAGAAAAGTGATTCCTT
AGTACAGAAGGAACAGAAACCGGTGGAAAGTGCTGATGAGCCTCTGCTCCCTGAGGTCAA
GGAAGAGAGAACTCGGAGGAGCCAATTCGTGCAGGGGCTGGTATTGTCCCTGATGTTTGA
TGACATCTTGTGAAGAGTTACATTCTAAAAATTGATTGAAGGCAACAGTCGCTTCCGCGA
AACAGTATAATACCAAGCGGAAGTTGCTGATGTCTAAGCTGATTTGCCATCTGAAGATGA
CAGCATTGTTCTAGGATCATCAGAAGGATGAATTTGTGAATATATGGATGCTCGTTAGCA
TGTCACGGGTGTGTCGCCTCAACAAATAAGATTATATGTATATTTTGGTAACATCACGAA
TACCTGTGTTATCAGGAGACCCAAGTGGTAACATCACGAATACCTGTGTTATGGTCCATG
TAATCAAGGTATGTAAGATCAAGGTACACGCGTGACAAATCGATGAAAATTCAAGGTAGG
CATCAGCATCAACTCCACACAATTGAAGGTTTGAAGAAACAATGACATTCTTCAGCCTTG
GAAGTATACATATCAACTTGAAATATTATATTCATACATAAATGAAGTGTGTGTGCATGT

CDS

657 bp

>Os12t0556100-01 Similar to fiber protein Fb2.
ATGGACATGGACTCGTGGGAGCGCCTCGCCGCGGACGCCAGGCTGCAGGGTTCGTGCTTC
GATGCGTTGATTGGGATGGAGGAGGCGGAGGGGAGCGAAGGCGAGGAGGAGGCGGCGGAG
GTGGCGTGCCCGTTCTGCGACGAGGAGTTCGACGGATTCGGGCTTTGCTGCCACATCGAG
GACGAACACCAGGCGGAGAACAGGGCCGGGGTGTGTCCAATTTGCTACGATGCGGTTGGG
ATGGACTTGGTTAGTCACATCACTTCGGAACATCCCAGTTTCTTCAAGGGCAAATGGAGA
AATCGGCGAGTTTCACATGGATCACATTCTTCAACGCGTGCCACATTAAAAAAGGACGCG
GCATATCTGCAGTACCGTTATGGAGGATCCACACGTGCTGCTTCACACAACACAGATCCT
GATCCTCTACTATCCTCTTTTGTTGGTAACTTCACCGACACAGATTTACCAAAAGATGTA
CAACAAGAGTTCCGAGATGAAACGGATGAGAAAAGTGATTCCTTAGTACAGAAGGAACAG
AAACCGGTGGAAAGTGCTGATGAGCCTCTGCTCCCTGAGGTCAAGGAAGAGAGAACTCGG
AGGAGCCAATTCGTGCAGGGGCTGGTATTGTCCCTGATGTTTGATGACATCTTGTGA

Protein

219 aa

>Os12t0556100-01 Similar to fiber protein Fb2.
MDMDSWERLAADARLQGSCFDALIGMEEAEGSEGEEEAAEVACPFCDEEFDGFGLCCHIE
DEHQAENRAGVCPICYDAVGMDLVSHITSEHPSFFKGKWRNRRVSHGSHSSTRATLKKDA
AYLQYRYGGSTRAASHNTDPDPLLSSFVGNFTDTDLPKDVQQEFRDETDEKSDSLVQKEQ
KPVESADEPLLPEVKEERTRRSQFVQGLVLSLMFDDIL*

5'UTR

chr12:22616804..22616999 (+ strand) : 196 bp

CDS

chr12:22617000..22617060 (+ strand) : 61 bp

chr12:22617186..22617334 (+ strand) : 149 bp

chr12:22619893..22619970 (+ strand) : 78 bp

chr12:22621047..22621312 (+ strand) : 266 bp

chr12:22621608..22621710 (+ strand) : 103 bp

3'UTR

chr12:22621711..22622177 (+ strand) : 467 bp

FASTA

>Os12t0556100-01 class=Sequence position=chr12:22616804..22622177 (+ strand)
GCCACACACT CTCCCTCTCC GTGTCGGTGT CTCATCTCTC TCTCTCTTCC CATCCGCCGC CAAAACCCTA GCCCCCCCTA
AACCCCGCCG CCCGATCGCC GCCGCCGCCG CCGCCCTCCC GCTTTCGCGG CCTCCGGTTT GGGCGCCCCC CCCCCGCCCG
GCCCAAGAAC CGTGTGCCCC CGCCGCCGCC GCCGCGATGG ACATGGACTC GTGGGAGCGC CTCGCCGCGG ACGCCAGGCT
GCAGGGTTCG TGCTTCGGTA GGGCCAAAAG ATTCGGTTTC GATCTTGCGT GCGGAATTTC GGTGGTGGTT GTGTTTTATT
TTATTTTTTT TTATTTTTTG GTGTGTGTGT GTGGGGTTTT TGATTTTGTG GTGTGGTGGC AGATGCGTTG ATTGGGATGG
AGGAGGCGGA GGGGAGCGAA GGCGAGGAGG AGGCGGCGGA GGTGGCGTGC CCGTTCTGCG ACGAGGAGTT CGACGGATTC
GGGCTTTGCT GCCACATCGA GGACGAACAC CAGGCGGAGA ACAGGGCCGG GGTAATCATC CAATCGATCG ATCTCAAGCC
CGAAACAAAA ATATAAAGAA AGAAAGATAG TAACAAAATT GTACTGATCC TTTAGTTGCT TTGCTTCCGG CAAAGAAACG
TCGGGCCTTT GCTTATTAAC GTTCGCTGTA AAATGGTTGG GCGAATTGTT TATTTCGTAT GGTTTCTTGA GGAATGCCTG
TGCTTGCGCG GTGATTTTAG TCGCTAAGAA AAGGGTTTTG ATTCCAAGGT AGGATTGTTG GGGGGCGCCT TAGTTGTTTT
TGGTTCCGTA CTATGCGCGT TCGATGCTTT TTATTCGTAG TGAAGCGGAT GTTGTTTTTA AGATGTGTAT GGTGCTTCTA
CTTATATGTA CACAGGTGCA TTTTAGCTAC CTTTTGATAT TAAGGTGTAA ATTCAGTTCC GTTGATGGTT TTCTTTGGGT
GCATAGTGCG GTCCTGTTCA TCAGCATGGT GTCTTTCAGC TGCTTTTTGT TGTGGCATTG ATACTTTAGT CACCTTGGTG
CGATCTTTTT GGGCTCATAG GGCAGTGTTA CCTGGACACG GGCACGTGTG TCAGAATCCG ACTTGGATTC GCATGTCCGA
TTCGGCAAAA AAGAATTAGA CACACAAAAT ACCTCTTTTT GGAATCCTAC TCAGACTTGG GGTGTCCAAT TTGGGGGGAA
AAAATCTGGA CATGGGTGTC CAGGTAACAC ACTAACACTG CCATATCATA TAGGGTTCTT ATGCTCGTAT AGCAAACATG
TTCGAGCTGT TTTTAGTTCC TAAGTAATGA TTTTAGTTGC AAAAATTTGA TTTTGTAGGT TTATAAATTG ATTCATGAAG
TGTTTCTGAG CTGTTTTCAC TATAGAGTTC TGAAGGTAGA AGTTTTTTAA TTTGATTGTG CCACGTCTGT CCAGTTTGCC
AAACGTCAAA AGCCATAAAT GAAGGCAAAT CAGCTAGGTG ACCTTAGTGT GTGCCGCGTG CCTAGGTGGC CGTACGTGTG
TCCACTTCAT TGATTGTAAC TGTTAAATTG CATATACTTT AGGAAACCTA TAATTTATGA TAATATTTTA GATGTTCCAG
GTGGTGCCTA ATATAGTATT TGTGGTATAG CTAATAATAC AACCACAATA TATATAAGCT TCTTTTTTTT TCTTCGAAAT
TTCATACCTT TTATAGTCAA ATCATTATAC AGTCATCAAT GTCAAGGGTC TTTACGTGCT TTTGGCAAAT ACATGTGCAT
CGGGCTATTA ACTTTGAGAT GTTTGGCTGG CTTTTGAATA CTTGTGTGTC TAATTGTGTT CTTAAATGGG CTTAATATGC
TCTTCCTTTG TGAGGAATTG GGCTGCTTTT GGTTGAATGT GATAATCCCA TTACTTTTCT TAGTGCGCAT GCAATTCATT
TTATGTTGAT AAGAATTACA AGACACAACT ATTTTAGCCA GTTTTCTAAC ATCTAAGTGT TTTCCGCCTA GCCTACCTAG
AGCCCTAGTG GTGATTGGCA GAATTCTTCC CTTTTGCCTG CCAAGCCAAT TTATCCCACC TAGGCCTGCT GATTTGTCGT
TAGGTGCTTG TCTGTGATCC TATAAGGCTT CTAGCACATT GATGTATGCT GATGTAGTGA TTTTAGCTTT TCTATTTTTG
CCACAATGAT CACAATTCTT AAGGACAGCT GTACTCTTGG GTGGTTTTCA GGTATTTAAG CTGCAAAATT TTTGTGATTC
GCCCTTTGAT TTTATCCGAG TAGATGTGAA TAACTTTTTG TTGTTTCCAT GGAATGCTTT TGTATCAGAT CCTTTTAGTT
ACAGTACTAT GAATTTAGTT GGATTGTGGA TTTTCGGCAG TAATAAGGTT CTTCTGCCAT AGTAGTAGTA TAATTTCTAT
AAAAAAAAAC TAATACTATT TAGCTGTTTT CCCTTTTTTA AAGATCTTAG TTTTACTAGC TTAAGCGGGA TTGGGGCAAA
ACTTTCTTCT GCATCCCAAT CTTTCATTGT GCTGCCGAGC TTAGTATCAT TGACTTTGAG TGTGCAATGT CCAATAAAAT
GCTAAAATCT GGCTGTTTCC AAACTCCAAT GGAGTGAAAG GTTCTGCTTG TAGTTTCTAG ATGTAGTTCT CTGAGTAGTT
TTGGGCTGTA GTGTTAGTAA GTGGATTTGA GGTTGAGTAG ATAATGTTTC ACTCATTTTG TCTTTATCCC ATTATGAGTT
TTCATTTAAT CCCATTATGA GTTTTCATTT AATAGGTGAT GGACTTAACA CACTATTATG TCATGCCCAT TTAATTATGT
AGCTTACTGC ACAGCACATT AGTGCCTGCT GTTTCTGGTA CTGAGGAGAA CATAGGCTGT TTCTGGTACT GAGGAGAACA
TAGGCTAGAA TATGTAGACC CTACATAATA TCATCTGAGT ACTAAGCATG TGAATCTTAA AACATCAAGA AGTTATTTGT
AGTTGAAGAT TGTGTTGAGT TATGTATATT GTTTTGCTAC AGAACTTGTA CTTAAAAGGT GTTTTTATGC TAATACATTT
ATTTTAGCTG CTTTTTTTTT GTGTAATTGT ATTGTTGTTG TTCTTTCAGG TGTGTCCAAT TTGCTACGAT GCGGTTGGGA
TGGACTTGGT TAGTCACATC ACTTCGGAAC ATCCCAGTTT CTTCAAGGTA TCAGTACTTC CAACATTCAT CAGCTATTCA
TTAGTCAATT AATTCCACTA TTATAATATT GGGGTATTGC ATATATGCCA GTAGGGTCTA GGGTAATTGT CAATCTGCTA
CTTGTTTTTT TGCTAATATC AAATTGTATG TGATAGATGG TTGTTATGTA TGAATCAAAT TCCAGGAAAT AAGTTGCAAA
CTTTGTTGAT TCCCCCATCG GTCTTATTCT ACTGGATTTG GATTGCTGTT TTTTTTCCCA GAATACCATT GTGTCAGATC
CTTTTAGCAG CTACTGCCAT ATATAAGGTG GTAGTATCTT TTCTATCAAA AAAGGAGTAC CATTGAATTC TTGTTTTCCT
AGTTAAAATT CCTACCTGGG AATTTGGCCA TCTTTTCTTC TGCATCCCAA CTTTCCATTG ATGGTGTTGA GCTTCACATC
ATTAGCTTCA GTGTACAACA ATATCAATTC AAAGGCTGAA ATCCGACTGT GTCCAATATA GTCTCCCAAG TGAAATGTTC
TACAGCAGTT GAGTAGACTA TGTTTGTTTA TTCCATTTTA TCTTGGTTCT AATGATTTAC GGATTTTCAG TTTGGTGGGC
TTAAAGCTGA ATCTTGCCAT GCCCATTAAA TTATCGCTCA GTGCATATTT CCTGCTATGT TCTATAGTGG CCAACTGGCA
CTACTAAATT AATTAACTGG AGCTTTGTAT GATAGTAGCA TTGACAGGGC CGGTCCTTCT AGCATAGCAT TCAGGTGATG
TCATGGAACT GCAGTAAAAG TGTAGAGCCA GTACAATTTG TTTCATAGGC AGAAAAATAC AGATCTTGTA GCGATTACCA
AGCTTCTTCT GTAATTGATT AATTAATGGC ATCAATAGTA TGAGAGAGAA TCACACATAT ATACCATGTC AATTCACCAC
TCGTTTTTGG CTCATATCAA ATTTTATGTG ACAGATGGTT ATTTATATAT AAATCATTGA GGCGTGGTTG ACAATTCTGG
AAACATATCA TAAAAAATTT ATTTATTTTC TGATGAAAAT ATGTACTTAT TGTTTAACTC CCTTGACCTA AACTAATTTG
CAGGGCAAAT GGAGAAATCG GCGAGTTTCA CATGGATCAC ATTCTTCAAC GCGTGCCACA TTAAAAAAGG ACGCGGCATA
TCTGCAGTAC CGTTATGGAG GATCCACACG TGCTGCTTCA CACAACACAG ATCCTGATCC TCTACTATCC TCTTTTGTTG
GTAACTTCAC CGACACAGAT TTACCAAAAG ATGTACAACA AGAGTTCCGA GATGAAACGG ATGAGAAAAG TGATTCCTTA
GTACAGAAGG AACAGAAACC GGTGGAAAGG TATTGAAAAC TTTTTGAAAA TCAATACGTA TTTTTTTTGT ATTACTGTAC
ATCAAATCTT TGGCATTAGT TCTAGTATGC AATTGCTTCA TTTTATAGCC ATTAGTTAGT AAATCTGTAA CACTGAAGAT
ATAGTTCATT AAGTCATTGG CTTCAAGAAG GATGCTGTTC TTCTATAAAC ACTGCCTATT AGTAGAATTA TTATACAAAC
ACATCTCATT TTACCAATGA TTAAATTTTA TGTTCAGCAT GATGATGCAC TGACTTTGGT AACTTTTTTT TTTTTTTTGG
CCAGTGCTGA TGAGCCTCTG CTCCCTGAGG TCAAGGAAGA GAGAACTCGG AGGAGCCAAT TCGTGCAGGG GCTGGTATTG
TCCCTGATGT TTGATGACAT CTTGTGAAGA GTTACATTCT AAAAATTGAT TGAAGGCAAC AGTCGCTTCC GCGAAACAGT
ATAATACCAA GCGGAAGTTG CTGATGTCTA AGCTGATTTG CCATCTGAAG ATGACAGCAT TGTTCTAGGA TCATCAGAAG
GATGAATTTG TGAATATATG GATGCTCGTT AGCATGTCAC GGGTGTGTCG CCTCAACAAA TAAGATTATA TGTATATTTT
GGTAACATCA CGAATACCTG TGTTATCAGG AGACCCAAGT GGTAACATCA CGAATACCTG TGTTATGGTC CATGTAATCA
AGGTATGTAA GATCAAGGTA CACGCGTGAC AAATCGATGA AAATTCAAGG TAGGCATCAG CATCAACTCC ACACAATTGA
AGGTTTGAAG AAACAATGAC ATTCTTCAGC CTTGGAAGTA TACATATCAA CTTGAAATAT TATATTCATA CATAAATGAA
GTGTGTGTGC ATGT

Locus: Os12g0556100

Loading...

Locus: Os12g0556100

Loading...