Os12t0560200-00

Locus

Os12g0560200

Description

Similar to Lipoxygenase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

LOX12

CGSNL Gene Name

LIPOXYGENASE 12

Oryzabase Gene Symbol Synonym(s)

OsLOX12

Oryzabase Gene Name Synonym(s)

lipoxygenase 12

Transcript Evidence

FJ667775 (DDBJ, Best hit)

Protein Evidence

A2ZLM2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen (GO:0016702)

Molecular Function: metal ion binding (GO:0046872)

Functional domain (InterPro)

Lipoxygenase (IPR000907)

Lipoxygenase, C-terminal (IPR013819)

Expression Databases

TENOR (Os12t0560200-00)

Others

Oryzabase (10395)

Transcript

301 bp

>Os12t0560200-00 Similar to Lipoxygenase.
ATCCTGTCAGGGTTTTGCTGGACACGTTCCCGTCGCAGTACCAGACTACCCTCATCTTGC
CAGCGCTCAACCTGTTGTCGTCGCACTCGCCAAGCGAGGAGTACATGGGCACGCACACGG
AGGCGGCGTGGATGGCAAACAGGGAGGTGAGGGCGGCGTTCGGGAGGTTCAACGAGAGGA
TGATGAGGATCGCGGAGACGATCGACCGCCGGAACAGGGATCCGGAGCGGAGGAACCGGT
GGGGCCCTGGTGTGGTGCCATATGTGCTGCTAAAGCCGTGCTATGGTGACCCCAAGGACA
T

CDS

299 bp

>Os12t0560200-00 Similar to Lipoxygenase.
CCTGTCAGGGTTTTGCTGGACACGTTCCCGTCGCAGTACCAGACTACCCTCATCTTGCCA
GCGCTCAACCTGTTGTCGTCGCACTCGCCAAGCGAGGAGTACATGGGCACGCACACGGAG
GCGGCGTGGATGGCAAACAGGGAGGTGAGGGCGGCGTTCGGGAGGTTCAACGAGAGGATG
ATGAGGATCGCGGAGACGATCGACCGCCGGAACAGGGATCCGGAGCGGAGGAACCGGTGG
GGCCCTGGTGTGGTGCCATATGTGCTGCTAAAGCCGTGCTATGGTGACCCCAAGGACAT

Protein

99 aa

>Os12t0560200-00 Similar to Lipoxygenase.
PVRVLLDTFPSQYQTTLILPALNLLSSHSPSEEYMGTHTEAAWMANREVRAAFGRFNERM
MRIAETIDRRNRDPERRNRWGPGVVPYVLLKPCYGDPKD

5'UTR

chr12:22936472..22936473 (+ strand) : 2 bp

CDS

chr12:22936474..22936772 (+ strand) : 299 bp

FASTA

>Os12t0560200-00 class=Sequence position=chr12:22936472..22936772 (+ strand)
ATCCTGTCAG GGTTTTGCTG GACACGTTCC CGTCGCAGTA CCAGACTACC CTCATCTTGC CAGCGCTCAA CCTGTTGTCG
TCGCACTCGC CAAGCGAGGA GTACATGGGC ACGCACACGG AGGCGGCGTG GATGGCAAAC AGGGAGGTGA GGGCGGCGTT
CGGGAGGTTC AACGAGAGGA TGATGAGGAT CGCGGAGACG ATCGACCGCC GGAACAGGGA TCCGGAGCGG AGGAACCGGT
GGGGCCCTGG TGTGGTGCCA TATGTGCTGC TAAAGCCGTG CTATGGTGAC CCCAAGGACA T