Os12t0560700-01

Locus

Os12g0560700

Description

Similar to PROLIFERA protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

MCM7

CGSNL Gene Name

MINI-CHROMOSOME MAINTENANCE PROTEIN 7

Oryzabase Gene Symbol Synonym(s)

OsMCM7

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK073411 (DDBJ, Best hit)

Protein Evidence

NP_001105524.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: DNA replication (GO:0006260)

Biological Process: DNA-dependent DNA replication initiation (GO:0006270)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Mini-chromosome maintenance, DNA-dependent ATPase (IPR001208)

Mini-chromosome maintenance complex protein 7 (IPR008050)

Nucleic acid-binding, OB-fold (IPR012340)

Nucleic acid-binding, OB-fold-like (IPR016027)

Mini-chromosome maintenance, conserved site (IPR018525)

Full-length cDNA

J033041P20 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0560700-01)

RiceXPro (AK073411)

Others

Oryzabase (9197)

KEGG (Os12t0560700-01)

Transcript

2670 bp

>Os12t0560700-01 Similar to PROLIFERA protein.
GCCATTTCCCCCAACCCCTCTGAATTTCCCTCCCTTTCCCTCTCCTCCCCTCCTCCTCCT
CCCGCCTCCGCCGCCGCCGCCGCCGACTACGCCATGGCCGCCACCGCGACGAAGACCATC
GACTTCGCCGCGGAGAGAGCGCTCGCCAAGGACTTCCTCGCCAACTTCGCCGGCCCGCGC
GGCGAGCCCAAGTACCTCAACATCCTCCAAGATGTCGCGAACCGGAAGATCCGCGCGGTC
CAGATCGAGCTGGACGACCTGTTCCACTACAAGGATGCGGATGACGAGTTCTTGCAGAGG
GTCACGGAGAACACGAAGCGCTACATCGGCATATTCGCGGACGCCATCGACGAGCTCATG
CCGGAGTCCACCGAGGCGTACGCCGTCGACGAGGACAGGGACATCTTGATGACGCAGCGC
GTCGACGAGGGAGCCGATGGCGGCGCAGACGGCACTGACCCCCTGCAGAGGATGCCGCCG
GAGATCAGGCGGTTCTTTGAGGTGTACATCAAGGCTTTCTCAAAGGTGACTCCACTCACC
ATTAGGCAAGTGAAGGCATCCAACATCGGGCAGCTTGTCAAAATATCTGGAATCGTGACT
CGCTGCTCGGATGTGAAGCCCTTGATGCAAGTTGCTGTTTATACATGTGAAGAATGTGGT
TTTGAGATATACCAGGAAGTGACTGCTAGAGTATTTATGCCTCTCTTTGAATGCCCATCT
CAAAGGTGCAAGCTGAACAAAGCCAAAGGGAATCTAATCCTTCAACTGCGAGCATCAAAA
TTTCTGAAATTTCAAGAGGTGAAACTCCAAGAGTTAGCAGAACATGTACCAAAGGGTCAC
ATCCCACGTTCTCTGACTGTTCATCTTAGAGGAGAGCTGACTAGAAAGGTTGCACCTGGA
GATGTGGTTGAGATGTCAGGCATTTTCCTCCCCATGCCTTACTATGGATTCCGAGCCATG
CGTGCAGGATTGGTTGCTGATACCTACTTGGAATCAATGTCTATCACCCATTTCAAGAAA
AAATATGAAGAATATGAACTTAAAGGTGATGAACAAGAACAAATTGACCGTTTGGCTGAG
GATGGTGATATCTACAATAAGTTGGCAAGGTCTTTGGCACCTGAAATATTTGGACATGAA
GATGTCAAGAAAGCACTGCTGTTGCTACTTGTTGGCGCACCTCATCGGAAGCTTACAGAT
GGCATGAAGATAAGAGGAGACTTGCACATATGCCTGATGGGAGATCCTGGTGTTGCAAAG
AGTCAACTTCTGAAGCATATCATCAATGTTGCTCCAAGAGGAGTGTATACCACAGGGCGT
GGAAGCAGTGGTGTTGGTCTTACTGCTGCCGTCCAGAAAGATCCAGTTACAAATGAGTTT
GTTCTTGAGGGAGGAGCACTGGTACTGGCAGATATGGGTATTTGTGCAATAGATGAGTTT
GACAAGATGGAAGAGTCAGACAGGACAGCAATCCATGAGGTGATGGAGCAGCAGACTGTT
AGTATTGCGAAGGCTGGAATCACCACCTCCCTCAATGCAAGAACGGCAGTTTTGGCTGCT
GCAAATCCAGCATGGGGAAGGTATGATATGAGGAGGACCCCAGCTGAAAACATCAATCTA
CCTCCAGCACTTCTGTCTCGTTTTGACCTCCTTTGGTTGATCCTGGATCGCGCGGACATG
GAAACCGATCTTGAAATGGCAAGACATGTTGTTCATGTACATCAAAACCTTGAATCACCA
GCTCTGGGGTTCACACCACTTGAACCACCAGTTCTTAGGGCATACATATCTACTGCGAGA
AGAGTTGTTCCTTCTGTTCCTCGAGAGCTTGAGGAATACATTGCAACTGCCTATTCGAGC
ATCCGCCAAGAGGAAGCAAAATCAAATGCACCACACTCCTACACAACTATCAGGACACTT
TTGAGCATACTCCGGATTTCTATTGCCTTGGCAAGGCTTAGATTCTCAGAAACCGTCGCT
CAGAGCGATGTCGATGAAGCGCTTCGGCTGATGCAGATGTCAAAGTACTCCCTATACTCA
GATGACCGCCAGCGGTCTGGATTGGACGCGATTTCTGACATATATTCCATTCTGAGAGAT
GAAGCTGCAAGAACTAACAGCATGGATGTCAGATATGCTCATGCCCTTAACTTGATCTCC
AGAAAGGGTTACAGCGAGGCTCAACTGAAGGAATGCTTGGAGGAGTATGCTTCCCTGAAT
GTTTGGCAGATCCACCCCAACACCTTTGATATCCATTTCATCGACGCGTAATGCAGGAAG
AATTGATCGATCGATCTCCTCTCCTTCAAAGTTCTAACATACCCATGATGAGCTCATGAT
GGAAAATCTAGAGTTTGAAGCTCCAGGAAGTTGTGACCATGGCTAGGGAAGCCATTGATC
AAGGTCTAACAAGGCTGTAAAAGTACTAGGGATCTTAGATAAACTATAATTTTCAATGAT
GTTATTCTGGGTAGATGTAGCCTGTGAGAAATGTATTAGTAGAGGGAGCCATTGCTATCA
TTGTCCACCTTGTGAGAAGCATTGTGGTTTTTTCAGCCATATTCTTGACTCTTGTTCAAC
ACTTGATACTGAAGTGTATGTATCATGTTGTGTTTAGTTGCTGGCATTTATGTTCTCAGA
CAGCAGCGATTAAAAAAAACAGAAAATTTC

CDS

2178 bp

>Os12t0560700-01 Similar to PROLIFERA protein.
ATGGCCGCCACCGCGACGAAGACCATCGACTTCGCCGCGGAGAGAGCGCTCGCCAAGGAC
TTCCTCGCCAACTTCGCCGGCCCGCGCGGCGAGCCCAAGTACCTCAACATCCTCCAAGAT
GTCGCGAACCGGAAGATCCGCGCGGTCCAGATCGAGCTGGACGACCTGTTCCACTACAAG
GATGCGGATGACGAGTTCTTGCAGAGGGTCACGGAGAACACGAAGCGCTACATCGGCATA
TTCGCGGACGCCATCGACGAGCTCATGCCGGAGTCCACCGAGGCGTACGCCGTCGACGAG
GACAGGGACATCTTGATGACGCAGCGCGTCGACGAGGGAGCCGATGGCGGCGCAGACGGC
ACTGACCCCCTGCAGAGGATGCCGCCGGAGATCAGGCGGTTCTTTGAGGTGTACATCAAG
GCTTTCTCAAAGGTGACTCCACTCACCATTAGGCAAGTGAAGGCATCCAACATCGGGCAG
CTTGTCAAAATATCTGGAATCGTGACTCGCTGCTCGGATGTGAAGCCCTTGATGCAAGTT
GCTGTTTATACATGTGAAGAATGTGGTTTTGAGATATACCAGGAAGTGACTGCTAGAGTA
TTTATGCCTCTCTTTGAATGCCCATCTCAAAGGTGCAAGCTGAACAAAGCCAAAGGGAAT
CTAATCCTTCAACTGCGAGCATCAAAATTTCTGAAATTTCAAGAGGTGAAACTCCAAGAG
TTAGCAGAACATGTACCAAAGGGTCACATCCCACGTTCTCTGACTGTTCATCTTAGAGGA
GAGCTGACTAGAAAGGTTGCACCTGGAGATGTGGTTGAGATGTCAGGCATTTTCCTCCCC
ATGCCTTACTATGGATTCCGAGCCATGCGTGCAGGATTGGTTGCTGATACCTACTTGGAA
TCAATGTCTATCACCCATTTCAAGAAAAAATATGAAGAATATGAACTTAAAGGTGATGAA
CAAGAACAAATTGACCGTTTGGCTGAGGATGGTGATATCTACAATAAGTTGGCAAGGTCT
TTGGCACCTGAAATATTTGGACATGAAGATGTCAAGAAAGCACTGCTGTTGCTACTTGTT
GGCGCACCTCATCGGAAGCTTACAGATGGCATGAAGATAAGAGGAGACTTGCACATATGC
CTGATGGGAGATCCTGGTGTTGCAAAGAGTCAACTTCTGAAGCATATCATCAATGTTGCT
CCAAGAGGAGTGTATACCACAGGGCGTGGAAGCAGTGGTGTTGGTCTTACTGCTGCCGTC
CAGAAAGATCCAGTTACAAATGAGTTTGTTCTTGAGGGAGGAGCACTGGTACTGGCAGAT
ATGGGTATTTGTGCAATAGATGAGTTTGACAAGATGGAAGAGTCAGACAGGACAGCAATC
CATGAGGTGATGGAGCAGCAGACTGTTAGTATTGCGAAGGCTGGAATCACCACCTCCCTC
AATGCAAGAACGGCAGTTTTGGCTGCTGCAAATCCAGCATGGGGAAGGTATGATATGAGG
AGGACCCCAGCTGAAAACATCAATCTACCTCCAGCACTTCTGTCTCGTTTTGACCTCCTT
TGGTTGATCCTGGATCGCGCGGACATGGAAACCGATCTTGAAATGGCAAGACATGTTGTT
CATGTACATCAAAACCTTGAATCACCAGCTCTGGGGTTCACACCACTTGAACCACCAGTT
CTTAGGGCATACATATCTACTGCGAGAAGAGTTGTTCCTTCTGTTCCTCGAGAGCTTGAG
GAATACATTGCAACTGCCTATTCGAGCATCCGCCAAGAGGAAGCAAAATCAAATGCACCA
CACTCCTACACAACTATCAGGACACTTTTGAGCATACTCCGGATTTCTATTGCCTTGGCA
AGGCTTAGATTCTCAGAAACCGTCGCTCAGAGCGATGTCGATGAAGCGCTTCGGCTGATG
CAGATGTCAAAGTACTCCCTATACTCAGATGACCGCCAGCGGTCTGGATTGGACGCGATT
TCTGACATATATTCCATTCTGAGAGATGAAGCTGCAAGAACTAACAGCATGGATGTCAGA
TATGCTCATGCCCTTAACTTGATCTCCAGAAAGGGTTACAGCGAGGCTCAACTGAAGGAA
TGCTTGGAGGAGTATGCTTCCCTGAATGTTTGGCAGATCCACCCCAACACCTTTGATATC
CATTTCATCGACGCGTAA

Protein

726 aa

>Os12t0560700-01 Similar to PROLIFERA protein.
MAATATKTIDFAAERALAKDFLANFAGPRGEPKYLNILQDVANRKIRAVQIELDDLFHYK
DADDEFLQRVTENTKRYIGIFADAIDELMPESTEAYAVDEDRDILMTQRVDEGADGGADG
TDPLQRMPPEIRRFFEVYIKAFSKVTPLTIRQVKASNIGQLVKISGIVTRCSDVKPLMQV
AVYTCEECGFEIYQEVTARVFMPLFECPSQRCKLNKAKGNLILQLRASKFLKFQEVKLQE
LAEHVPKGHIPRSLTVHLRGELTRKVAPGDVVEMSGIFLPMPYYGFRAMRAGLVADTYLE
SMSITHFKKKYEEYELKGDEQEQIDRLAEDGDIYNKLARSLAPEIFGHEDVKKALLLLLV
GAPHRKLTDGMKIRGDLHICLMGDPGVAKSQLLKHIINVAPRGVYTTGRGSSGVGLTAAV
QKDPVTNEFVLEGGALVLADMGICAIDEFDKMEESDRTAIHEVMEQQTVSIAKAGITTSL
NARTAVLAAANPAWGRYDMRRTPAENINLPPALLSRFDLLWLILDRADMETDLEMARHVV
HVHQNLESPALGFTPLEPPVLRAYISTARRVVPSVPRELEEYIATAYSSIRQEEAKSNAP
HSYTTIRTLLSILRISIALARLRFSETVAQSDVDEALRLMQMSKYSLYSDDRQRSGLDAI
SDIYSILRDEAARTNSMDVRYAHALNLISRKGYSEAQLKECLEEYASLNVWQIHPNTFDI
HFIDA*

5'UTR

chr12:22959312..22959404 (- strand) : 93 bp

CDS

chr12:22959266..22959311 (- strand) : 46 bp

chr12:22959089..22959156 (- strand) : 68 bp

chr12:22958915..22958974 (- strand) : 60 bp

chr12:22958571..22958800 (- strand) : 230 bp

chr12:22957749..22957926 (- strand) : 178 bp

chr12:22957227..22957349 (- strand) : 123 bp

chr12:22957024..22957113 (- strand) : 90 bp

chr12:22956660..22956802 (- strand) : 143 bp

chr12:22956392..22956569 (- strand) : 178 bp

chr12:22956095..22956286 (- strand) : 192 bp

chr12:22955639..22955811 (- strand) : 173 bp

chr12:22955335..22955539 (- strand) : 205 bp

chr12:22955003..22955167 (- strand) : 165 bp

chr12:22954695..22954916 (- strand) : 222 bp

chr12:22954477..22954581 (- strand) : 105 bp

3'UTR

chr12:22954078..22954476 (- strand) : 399 bp

FASTA

>Os12t0560700-01 class=Sequence position=chr12:22954078..22959404 (- strand)
GCCATTTCCC CCAACCCCTC TGAATTTCCC TCCCTTTCCC TCTCCTCCCC TCCTCCTCCT CCCGCCTCCG CCGCCGCCGC
CGCCGACTAC GCCATGGCCG CCACCGCGAC GAAGACCATC GACTTCGCCG CGGAGAGAGG TACGCGACGC GCCCCCCTCC
CCTCCCCTCC AGAACCTTCC GGAACATCTC TTCTTGGAAC CTTCCAGAAC AAATCCCAAC TCACGTTGTG ATTTGTTCGT
CTCCGCAGCG CTCGCCAAGG ACTTCCTCGC CAACTTCGCC GGCCCGCGCG GCGAGCCCAA GTACCTCAAC ATCCTCGTAA
TGATCTCCAC CTCGCGTTCT ACCGATTGAG GATCTGAATT TCTTTATTTT CCACCGATTT GTTACTGTAA TTACTGAATT
TACTGTTCTT TTGTTGTGTC CCAACTCCAG CAAGATGTCG CGAACCGGAA GATCCGCGCG GTCCAGATCG AGCTGGACGA
CCTGTTCCAC GTACGGAATC TCTGAATCCT CCATCTCCTC CAGATCTACA ATTATTTTGA GATGCAAAAA GTCTGATATT
GTTTTTGGGG CGTGGAATTT TTTTTTTCTT GTGTGTTTGT GTAGTACAAG GATGCGGATG ACGAGTTCTT GCAGAGGGTC
ACGGAGAACA CGAAGCGCTA CATCGGCATA TTCGCGGACG CCATCGACGA GCTCATGCCG GAGTCCACCG AGGCGTACGC
CGTCGACGAG GACAGGGACA TCTTGATGAC GCAGCGCGTC GACGAGGGAG CCGATGGCGG CGCAGACGGC ACTGACCCCC
TGCAGAGGAT GCCGCCGGAG ATCAGGCGGT TCTTGTGAGT GTGCTGCCTC TGAATTTCTC ATGAAAATGT GATTTCCCTT
TTTGGAGAAT GAATAGTAGt agctgtgatt agggatgcaa gcgggcaatc ctactacccg tataagaacc cgcttaatag
ttcatttcgt acttgctagc acaaaaattt ggaagaaaaa aatgaagtag aattatgata agcaggcaaa aaaaaaaaaa
ctgtgcccgc cccactTGTA GAAGGAAAAT AGTGTCGCGA GAGTTACGAA GTTGTGCAAA CAGATTTTTA GATGGTCTTG
GTTGGTGAGA TTACATAATT TAGATGGTCC TAGGATTGCC ATGTCCCACC TTGACCTAGG AACTGAACAG TGAACACTAC
CTAAAAGATG CTATTGAGCA CAGTTTGGTA TGTTAACAAC AGTTGGTGCA TGTTCTGCAA TTATTTGTGC TTCCATGGAT
TATGTGATAA TGTAATGTGA CAGATTCTTG AATGCCACCG GAACGTTTGC CCATCTTATA TTGAAAGCTA AAATTGTCTG
TGCTCATGCA TTGCTTATTA TTTTTGTCCT TAAAAAATCA TTGCTTGTTT TTGTACTATG ATTTTGTTGG TTTTGTGTTG
AGCTTTTATC TGAATACCAA GTGGTTTTGA CATTGCAGTG AGGTGTACAT CAAGGCTTTC TCAAAGGTGA CTCCACTCAC
CATTAGGCAA GTGAAGGCAT CCAACATCGG GCAGCTTGTC AAAATATCTG GAATCGTGAC TCGCTGCTCG GATGTGAAGC
CCTTGATGCA AGTTGCTGTT TATACATGTG AAGAATGTGG TTTTGAGATA TACCAGGTAT TCATCTCTTC CAGGTTCCTT
TTTCCATAAG TAGTTTTGAT GAAGTGATGA CTATGTGTTG ACTGTATCGA TTATTTGCCC CCCTCAAGGA TTAGCGCTTT
AATGATTTTC CACTCCACTC CATGTGTTAA TCTTTAGCCT ATAATCCTAG ACCACTTTAG CCTATAATTC ATTGGATACT
CTACTCCATG TGTCAGGCAT ATTGTCCTTA ACTTTTAGCC TATATTCCTA GACTAGTTTA ACGTCTAATT CATCGGATGC
TATTTTTCAC TTTGTGCTAA ATTTAATTGA GCTGTGGAGC TAGTGGTTTT CACTTGCTGA GATATATTTA TATGTGCCTT
CTGGAAGAAA AATTCTAGAA TGACTATTAA CATTGTATTG TTCTGAATTT GACAGGAAGT GACTGCTAGA GTATTTATGC
CTCTCTTTGA ATGCCCATCT CAAAGGTGCA AGCTGAACAA AGCCAAAGGG AATCTAATCC TTCAACTGCG AGCATCAAAA
TTTCTGAAAT TTCAAGAGGT AATAACCCTT CTCCACAATC TGTGAAAGTT TACCTTCAAC AGGCAAAACT ATTCTTACTT
AGGCATATTC CAAATTGTAC TCAATCGTAG AACTGCAACA CTTTCTTGTA GGTGAAACTC CAAGAGTTAG CAGAACATGT
ACCAAAGGGT CACATCCCAC GTTCTCTGAC TGTTCATCTT AGAGGAGAGC TGACTAGAAA GGTACATCAA CTTGCAACTT
TCCCTTTGCT TTTGTTCTCT GTGTTGCTTT GTGAGTGGGA CCACAAAATT GATGTTTTTC CATAGGATCC ACCTCTGAAT
TTGAGAAGAG GCTGCTATAA GATTTCTGGT TTTCATTTAC TAAATATCCA TTATCTTAAT GCTGCCACAT AAGCAGGAAA
TATTCATTAA TGGCTCCAAG TACTAAATGC TGTTATTACC AGGTTGCACC TGGAGATGTG GTTGAGATGT CAGGCATTTT
CCTCCCCATG CCTTACTATG GATTCCGAGC CATGCGTGCA GGATTGGTTG CTGATACCTA CTTGGAATCA ATGTCTATCA
CCCATTTCAA GAAAAAATAT GAAGAGTAAA CCATCTCAGC CTAGCCATCC AGTCTATTCA GCTTGTCTCT CAGCGCCATT
TGACATTACA AATTTGTTGC AAAAAATCAT TGCAGATATG AACTTAAAGG TGATGAACAA GAACAAATTG ACCGTTTGGC
TGAGGATGGT GATATCTACA ATAAGTTGGC AAGGTCTTTG GCACCTGAAA TATTTGGACA TGAAGATGTC AAGAAAGCAC
TGCTGTTGCT ACTTGTTGGC GCACCTCATC GGAAGCTTAC AGATGGCATG AAGGTATGCA TGTTGTGTTG CCAGGACTTG
TGATCACTTG TATTCAGTAA TAAAACTTTA ATATCTCCAA CTGCTTGTAT ACTTAATGTT AACCCTCTTA ATGTGCAGAT
AAGAGGAGAC TTGCACATAT GCCTGATGGG AGATCCTGGT GTTGCAAAGA GTCAACTTCT GAAGCATATC ATCAATGTTG
CTCCAAGAGG AGTGTATACC ACAGGGCGTG GAAGCAGTGG TGTTGGTCTT ACTGCTGCCG TCCAGAAAGA TCCAGTTACA
AATGAGTTTG TTCTTGAGGG AGGAGCACTG GTACGATTCA GATCACACTT TACTTCTTTT TGCTGCTGGT TAACTGTACA
AAAGTTTGGT TGTATCAAGT GTTTATATGA AACTATGTTC AAGTCCTGAC TTGGGATGTT AAGAGAATAT GTCAATGAAA
GTTGCTTTGA CATCAATTAA GATTTTTCAT ACTTAAGTTT CACTGATGCA AATATTTTGT TTCACTCATG CGAACTGAAG
CATTTTATTT GAGAGCATGG CACAGCCTGT AATCCTCAAT GGTTAATCTC TATTGCGAAT TCTTGGGTTT CAGGTACTGG
CAGATATGGG TATTTGTGCA ATAGATGAGT TTGACAAGAT GGAAGAGTCA GACAGGACAG CAATCCATGA GGTGATGGAG
CAGCAGACTG TTAGTATTGC GAAGGCTGGA ATCACCACCT CCCTCAATGC AAGAACGGCA GTTTTGGCTG CTGCAAATCC
AGCATGGTAA GATTTGATCT CAACATTTTT CTTCTTGCTA GACTCTAGAG GATAACAAGA AAGATACCAG AGTTGTAACA
ATTGCAATTG CTTTTAACCA TTCAGGGGAA GGTATGATAT GAGGAGGACC CCAGCTGAAA ACATCAATCT ACCTCCAGCA
CTTCTGTCTC GTTTTGACCT CCTTTGGTTG ATCCTGGATC GCGCGGACAT GGAAACCGAT CTTGAAATGG CAAGACATGT
TGTTCATGTA CATCAAAACC TTGAATCACC AGCTCTGGGG TTCACACCAC TTGAACCACC AGTTCTTAGG CAAGTACACT
TTCCCTAGGG TCTTGTTACT TTGTCCTGAT TTTATGTAAA AAAATGTGCA TTACAATTTA CAAATAGCTA AAAGTTTTTC
CTTGAAAGCA ATCTTGTAAA TAGGCTGAAC TAGAATATTT TAGGAGTTTG TGTTAACAAT CTTGATCTGA TCACAGGGCA
TACATATCTA CTGCGAGAAG AGTTGTTCCT TCTGTTCCTC GAGAGCTTGA GGAATACATT GCAACTGCCT ATTCGAGCAT
CCGCCAAGAG GAAGCAAAAT CAAATGCACC ACACTCCTAC ACAACTATCA GGACACTTTT GAGCATACTC CGGATTTCTA
TTGTAAGCAA ACTTCATACT TTGTCTTTTG TTAACTGCAA GCATATGAAT CTCTTCTCAC AAAACACAAT GGTACCTGTT
TCTTTCAGGC CTTGGCAAGG CTTAGATTCT CAGAAACCGT CGCTCAGAGC GATGTCGATG AAGCGCTTCG GCTGATGCAG
ATGTCAAAGT ACTCCCTATA CTCAGATGAC CGCCAGCGGT CTGGATTGGA CGCGATTTCT GACATATATT CCATTCTGAG
AGATGAAGCT GCAAGAACTA ACAGCATGGA TGTCAGATAT GCTCATGCCC TTAACTTGAT CTCCAGAAAG GTACAGTTCC
TGCATTTCAT ACATCAATCA GCTGGTGCCA TTGCTAAAGC TCAATGTGGC CTAAATTCTA ACAAAAGCAA TCTTCTTCTG
CCTGTATGGA TGTAACAAAA CAGGGTTACA GCGAGGCTCA ACTGAAGGAA TGCTTGGAGG AGTATGCTTC CCTGAATGTT
TGGCAGATCC ACCCCAACAC CTTTGATATC CATTTCATCG ACGCGTAATG CAGGAAGAAT TGATCGATCG ATCTCCTCTC
CTTCAAAGTT CTAACATACC CATGATGAGC TCATGATGGA AAATCTAGAG TTTGAAGCTC CAGGAAGTTG TGACCATGGC
TAGGGAAGCC ATTGATCAAG GTCTAACAAG GCTGTAAAAG TACTAGGGAT CTTAGATAAA CTATAATTTT CAATGATGTT
ATTCTGGGTA GATGTAGCCT GTGAGAAATG TATTAGTAGA GGGAGCCATT GCTATCATTG TCCACCTTGT GAGAAGCATT
GTGGTTTTTT CAGCCATATT CTTGACTCTT GTTCAACACT TGATACTGAA GTGTATGTAT CATGTTGTGT TTAGTTGCTG
GCATTTATGT TCTCAGACAG CAGCGATTAA AAAAAACAGA AAATTTC

Locus: Os12g0560700

Loading...

Locus: Os12g0560700

Loading...