Os12t0569700-01

Locus

Os12g0569700

Description

Similar to Heat shock protein 70.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HSP23.7

CGSNL Gene Name

23.7 KDA HEAT SHOCK PROTEIN

Oryzabase Gene Symbol Synonym(s)

OsHsp23.7, OsHSP23.7

Oryzabase Gene Name Synonym(s)

23.7 kDa heat shock protein

Transcript Evidence

AK099797 (DDBJ, Best hit)

Protein Evidence

Q40693 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Heat shock protein Hsp70 (IPR001023)

Heat shock protein 70 (IPR013126)

Full-length cDNA

J013097I18 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0569700-01)

Others

Oryzabase (10375)

Transcript

3649 bp

>Os12t0569700-01 Similar to Heat shock protein 70.
ACTCAAGTCCTCCCATCCAGCAGCTCAGCCGCCACAAGCCATGGCCGATGCGAGCTCGGC
CGCCGTCGCTGCCCCCAAGCCCCAACTGGCCGCCGGCACTTGAGCACCAAGCAGGGCCAG
CTCGACGACGCCGTCGCCGCCCGCCACCAAGCTCGAACAGATCAGCTCCAGCAATGTTCA
ATCCAACGACTTTTGCATTGATTGATTGATTTTCTCTGCTCGTGTGATTGTGTGATTGGA
ATCGACTAGCTTGAACCAATTGATAGTATCCCTGTGCTGTGCGTGCATTGCATGTGTACA
TATTACCAAATCTCTGTTGCATATGGATCCACTCTTGGATATCGGTTTTCGCTTGAATGC
CGTTTTCTTCTGTTATTTTGTTGTTCCTTTTTTTAAGCTATAAAACCCAACCTTCTCTTT
ATGATCTGTTTGTTTTCAATATTGTAATTTTTTTTCTGGAATTTGTTGTTAATTATAACC
TTTTCATTATCTCCTGAGCTAGCAGATTGATGATGAAACAATTTCTCCAAGCGTTTGTTA
CGCTGACATCCATATATGATGGAGGGCTATGTTACCATAGCCTTCATAGTTTTCAATCTG
AACCATCTGCTGCTCAATCATTTTCCCCAGATTTTTTTTACAGCGATTGTTTCTCCATTG
CTAACTGTTCTGTATTGATTTGGGATTCAAATTCCTTTCATGGTTTTTGCTCGTTTTCTT
TACAATCTCATTCATTTGTCTGTGCAACATTTGGGAAAAATTGGGAGAAGTGATGATATT
ATATCCATACCACATTTCTGCATTCACTATGATGATCATTAACTTCATGCACTACCATCT
GATCTCCCACTACACATAATAAAGTTATGGTACAAGGTATATAAATTGAAGTTGTGCAAT
GATGGACTGATTTTCATTTACACGCTGAATTTATTTTGTTAATTAATGTGCAATCTGTGA
TGCAAATAATCCCATTTGCTGAATCACTGTGATTATTGCAATCAAAATCACCATCTTTCG
GCTGAGATTGCACATTGTTATTCTGCAAAATTTATCTTTGTTTTAAATTAAGGTTTATGC
CATTTGGTATCTGACACATAATCATTTCTCTGATTATGTGTCTCGAAACATGGCAGAAAG
TGAGGGGGAACGGTCCTTGCGACACTGGTTGCTACTATATGAGCTTCTAGTTACTATATA
CCCGTTTACATTTCCTTGCTTTTTTAGTATTTCTGTTTAACTTTTGTCATGCCTATGTGT
TGTGATGCATTAGTTTTGTACTGTGGAGATTGTACCCCTGTCAAACCACTTAATGAAATT
ACAGATAATTATTAGACTGAAAATGCCGTCTTTTGGCTGAATCACTCTGATCAATCAAAA
TCACCATATTTCAGCTGAGATTGCACATTGTTGTTACGCGAAACAATTTTATCTTTGTTT
TAAATTAAGGTTCAGCCATTTGGTATCTGACACATAATCATTTCTCTGATTACATGTCTC
GAAACATGGCAGAAAGTAAGGGGGAACGGTCCTTGCGATGCTGGTTGCTGCTATATGAGC
TTCTAGTTACTATATACCCGTTTACATATCCTTTGCTTTCTTAGTATTTCTGTTTGGCTT
TATTCATTAGTTATGCCTATGTGTTGTAATGCATTAGTTTTGTACTGTGGAGATTGTATG
TCTATCAAACTACTTAATGAAGTTACAGATAAATATTAGACTGAAAGTCTAAAATCACTG
TAGCATATTGGGCTAAAAGGTATAGTTTGTTTACTTGGAATCTCTCGAAAGTTTGTTTGA
TTGCTGAATTTGTGCTCCAGTTTGTTTGCTGTTTCTTACATGAAGCATTACCTGTCCTGA
TGTTATTTATCACTTATGAGATTTGTGTATGCAGTTTCCATTTTTTCAGTGCCTGTTATG
CAGATGCCAAGCGTCTCATTGGCCGGAGATTTACTGATGCTTCTGTCCAGagtgatatta
agctctggcccttcaaggtcattgctggacctggtgacaagtcaacgattgtggttcagt
acaagggtgaagagaagcaggttgcagctgaGATGCCAAGCGTCTCATCGGCCAGAGATT
TACTGATGCTTCTGTCCAGagtgatattatgctctggcccttcaaggtcatcgctggacc
tggtgacaagtcaatgattgtggtccagtacaagggtgaagagaagcagtttgcagctga
ggagatctcttctatggtcctcatcaagatgcgtgagattgctgaagcttaccttggcac
caccatAAAAAAAGCTGTCGTAACAGTTCCTGCTTACTTCAACTACTCACAGAGGCAGGC
TACCAAGGACGCTAGGGTCATTGCTGGCCTCAATGTCATGCGTATCATCAATGAGCCTAC
TGCTGCTGCCATTGCCTATGGTCTTGACAAGAAGGCTTCCAGTGTTGGTGAGAAGAACGT
CCTCATCTTCGACCTTGGTGGTGGTACCTTTGATGTCTCTCTTCTCACCATTGAGGAGGG
AGGTCAAGGCCACAGCTGGTGACACGCATCTTGGTGGTGAGGACTTTGACAACAGAATGG
TGAAGCACTTTGTTCAGGAGTTCAAGAGGAAGAGCAAGAAGGACATCACTGGCAACCCAA
GGCCTGTCGGGAGGCTGAGGACAGCTTGTGAGTGGGCGAAGAGGACTCTCTCCCCTCCAC
TTCCCAGACCACCCACCATTGAGATTGACTCCCTGTACGAGGGCATCGACTTCTACTCGA
ACATCACCTGCGCCAGGTTCGAGGAGCTGACCATGGATCTCTTCAGGAAGTGCATGAGGG
GATACCAAGATGGACAAAGAGCAGCGTGCACGATGTTCATCCTTGTTGGTGGCTCCACCA
GGATTCCCAGAGTGCAGCAGCTCCTCCAGGACTTCTTCAATGGCAAGGAGCTCTGCAAGA
ACATCAACCCTGATGAGGCCGTCGCCTATGGCGCCGCTGTCCAGGCCCCCATCTTGGTCT
GGAGACGGCCAGAGGAGTGATGACCTAGAAGGAGCAGGCCGGTCTTCTCCACCTACTCCG
ACAACCGGCCTGGTGTGTTGATCCAGGTGTACGAGGGCGATGGGAGAGGACCATGACACC
ATTGAGTAAGTGAGGAGATCGAGAAGATGGTCCAGGACGCGGAGAAGTACAAGTCGGAGG
ACGATGAGCTACATCGAAGAACATGCACAAACACCATCAAGGTCCGAGCACCCACGCGGC
GGCCAAGAAGATGGGAGGACGCGGTGGGAGATTGAGCCAAGATGGACGAGGACGTGCCGT
TAAATTTTGGCTGATCATGGTGGTTAAATTTTGGCTACGTTGTAATGAAAAATGCATTGG
TTGCTTCGTTAAAGTAATAGTACTACAATTGTTCTGTTTCGGTTCATCCGCATTTGCCTT
TTGATTTTTGTTTAGCTGCTACTTAAATCGCGTTTATTTTGCATACAGTATCTATCTGTC
TTCTCCAAAGCGTTGGGGTGTGCTTTTCTTCCCCGGTGGTATTCACTATTCAGAGTCTTT
TGTCGTCGTGTCTGCTCTAATATGCCATCCATTGTAGGGAGTGGATTACGTCCCCCCATC
GTGTATCTTTTTCTTTCAAAATCAATGCAAATAGTTGTTAAAAATTCTG

CDS

318 bp

>Os12t0569700-01 Similar to Heat shock protein 70.
ATGTTATTTATCACTTATGAGATTTGTGTATGCAGTTTCCATTTTTTCAGTGCCTGTTAT
GCAGATGCCAAGCGTCTCATTGGCCGGAGATTTACTGATGCTTCTGTCCAGagtgatatt
aagctctggcccttcaaggtcattgctggacctggtgacaagtcaacgattgtggttcag
tacaagggtgaagagaagcaggttgcagctgaGATGCCAAGCGTCTCATCGGCCAGAGAT
TTACTGATGCTTCTGTCCAGagtgatattatgctctggcccttcaaggtcatcgctggac
ctggtgacaagtcaatga

Protein

105 aa

>Os12t0569700-01 Similar to Heat shock protein 70.
MLFITYEICVCSFHFFSACYADAKRLIGRRFTDASVQSDIKLWPFKVIAGPGDKSTIVVQ
YKGEEKQVAAEMPSVSSARDLLMLLSRVILCSGPSRSSLDLVTSQ*

5'UTR

chr12:23442171..23444029 (+ strand) : 1859 bp

CDS

chr12:23444030..23444242 (+ strand) : 213 bp

chr12:23445618..23445722 (+ strand) : 105 bp

3'UTR

chr12:23445723..23447194 (+ strand) : 1472 bp

FASTA

>Os12t0569700-01 class=Sequence position=chr12:23442171..23447194 (+ strand)
ACTCAAGTCC TCCCATCCAG CAGCTCAGCC GCCACAAGCC ATGGCCGATG CGAGCTCGGC CGCCGTCGCT GCCCCCAAGC
CCCAACTGGC CGCCGGCACT TGAGCACCAA GCAGGGCCAG CTCGACGACG CCGTCGCCGC CCGCCACCAA GCTCGAACAG
ATCAGCTCCA GCAATGTTCA ATCCAACGAC TTTTGCATTG ATTGATTGAT TTTCTCTGCT CGTGTGATTG TGTGATTGGA
ATCGACTAGC TTGAACCAAT TGATAGTATC CCTGTGCTGT GCGTGCATTG CATGTGTACA TATTACCAAA TCTCTGTTGC
ATATGGATCC ACTCTTGGAT ATCGGTTTTC GCTTGAATGC CGTTTTCTTC TGTTATTTTG TTGTTCCTTT TTTTAAGCTA
TAAAACCCAA CCTTCTCTTT ATGATCTGTT TGTTTTCAAT ATTGTAATTT TTTTTCTGGA ATTTGTTGTT AATTATAACC
TTTTCATTAT CTCCTGAGCT AGCAGATTGA TGATGAAACA ATTTCTCCAA GCGTTTGTTA CGCTGACATC CATATATGAT
GGAGGGCTAT GTTACCATAG CCTTCATAGT TTTCAATCTG AACCATCTGC TGCTCAATCA TTTTCCCCAG ATTTTTTTTA
CAGCGATTGT TTCTCCATTG CTAACTGTTC TGTATTGATT TGGGATTCAA ATTCCTTTCA TGGTTTTTGC TCGTTTTCTT
TACAATCTCA TTCATTTGTC TGTGCAACAT TTGGGAAAAA TTGGGAGAAG TGATGATATT ATATCCATAC CACATTTCTG
CATTCACTAT GATGATCATT AACTTCATGC ACTACCATCT GATCTCCCAC TACACATAAT AAAGTTATGG TACAAGGTAT
ATAAATTGAA GTTGTGCAAT GATGGACTGA TTTTCATTTA CACGCTGAAT TTATTTTGTT AATTAATGTG CAATCTGTGA
TGCAAATAAT CCCATTTGCT GAATCACTGT GATTATTGCA ATCAAAATCA CCATCTTTCG GCTGAGATTG CACATTGTTA
TTCTGCAAAA TTTATCTTTG TTTTAAATTA AGGTTTATGC CATTTGGTAT CTGACACATA ATCATTTCTC TGATTATGTG
TCTCGAAACA TGGCAGAAAG TGAGGGGGAA CGGTCCTTGC GACACTGGTT GCTACTATAT GAGCTTCTAG TTACTATATA
CCCGTTTACA TTTCCTTGCT TTTTTAGTAT TTCTGTTTAA CTTTTGTCAT GCCTATGTGT TGTGATGCAT TAGTTTTGTA
CTGTGGAGAT TGTACCCCTG TCAAACCACT TAATGAAATT ACAGATAATT ATTAGACTGA AAATGCCGTC TTTTGGCTGA
ATCACTCTGA TCAATCAAAA TCACCATATT TCAGCTGAGA TTGCACATTG TTGTTACGCG AAACAATTTT ATCTTTGTTT
TAAATTAAGG TTCAGCCATT TGGTATCTGA CACATAATCA TTTCTCTGAT TACATGTCTC GAAACATGGC AGAAAGTAAG
GGGGAACGGT CCTTGCGATG CTGGTTGCTG CTATATGAGC TTCTAGTTAC TATATACCCG TTTACATATC CTTTGCTTTC
TTAGTATTTC TGTTTGGCTT TATTCATTAG TTATGCCTAT GTGTTGTAAT GCATTAGTTT TGTACTGTGG AGATTGTATG
TCTATCAAAC TACTTAATGA AGTTACAGAT AAATATTAGA CTGAAAGTCT AAAATCACTG TAGCATATTG GGCTAAAAGG
TATAGTTTGT TTACTTGGAA TCTCTCGAAA GTTTGTTTGA TTGCTGAATT TGTGCTCCAG TTTGTTTGCT GTTTCTTACA
TGAAGCATTA CCTGTCCTGA TGTTATTTAT CACTTATGAG ATTTGTGTAT GCAGTTTCCA TTTTTTCAGT GCCTGTTATG
CAGATGCCAA GCGTCTCATT GGCCGGAGAT TTACTGATGC TTCTGTCCAG agtgatatta agctctggcc cttcaaggtc
attgctggac ctggtgacaa gtcaacgatt gtggttcagt acaagggtga agagaagcag gttgcagctg aGGTAATATT
CAAATTGTTT CTGTGATGGC TACTTAGGAT TTATGCTATG ATTTTAACTT GCATTGTTGT AATGATGTTG TTAAAGTAAA
CAAGTAACGG TAGCAAGTTT GCTTATCAGC TTGTTGTTTT TCAGTTTTTC CTGTGAGCCT ATCTTTTCGT TCTTTTCCAT
TATAAAAACC CATCTCTCTT TATGGTCTGT TTGTTTTCTA TGTTATAAAT GTTTTTCTGT AATTTGTTGA CCTTTTCATT
AAATCTTGAG CTAGCAGATT GATGATGAAA CAATTTCTCC AAGCGTTTGT TACGCTGATC CATATGATGG AGGGCTATGG
TAACATAGCC TTCATAGTTT TCAATCTGAA CCATCTGCTG GTCAATCATT TTCCCCAGAT TTTTTTACAG CGATTGTTTC
TCCATGCATA CAGTTCTGTA TTGATTTGGG ATTGTACTAA CACTTAGCAT AACATACATT AATGAATTCC TTTCAAATTA
AGATTTCTAT TATAGTGCTA TTCAAATTCC TTATATGATT TTTGCTCGTT TTCTTTACAA AATCTCATTC AATTTTCTGT
GCAACGTTTG GGAAAAAAGT ATTATTTGGG AGAAGTGATG ATATTATATC CATACCACAT TTCTGCATTT GCTATGATGA
TCATTAAATT CATGCACTAC CATCTGATCT CCCACTACAC ATGATAAAGT TATTGTTACA AGGCTATATA AATTGAAGTT
ATGCAATGCT GGACTGATTT TCATTTACAA GCTGAATTTA TTTTGTTAGT GTGCAATCTG TGATGCAAAT AATCCCATTT
GCTGAATCAC TGTGATTATT GCAATAAAAA TCACCATCTT TTGGCTGAGA TTGCACATTG TTCTGCAAAA CATTTTTATA
TTTGTTTTAA ATTAAGGTTC ATGCCATTTG GTATCTGACA CATAATCATT TATCTGATTA TGCGTCTCGA AACATGGCAG
AAAGCGAGGG GGAACGGTCC TTGCGACACT GGTTGCTGCT ATATGAGCTT CTAGTTACTA TATACCCGTT TACATATCCC
TTGCTTTCTT AGTATTTCTG TTTGGCTTTA TTCATTAGTT ATGCCTATGT GTTGTGATAC ATAGTTTTGT ACTGTGGAGA
TTGTACGTCT GTCAAACTAC TTAATGAAAT TACAGATTAT TGGACCGAAA GTCTGAAACT ACTATAGTAT ATTAGACTAA
GGTTATATAG TTTGTTTACT TGGAATTGCT CCAAAGTTTG TCTGATTGCT GAATTTGTAC TCCGTTTGTT TGCTGTTTTT
CGCATGAAAC ATTACCAGTC CTGAAGATAT TTATCATACA TGAGGTTTGT GTATGCAGTT TCTGATTTTT TAGTGCCTCT
TATGCAGATG CCAAGCGTCT CATCGGCCAG AGATTTACTG ATGCTTCTGT CCAGagtgat attatgctct ggcccttcaa
ggtcatcgct ggacctggtg acaagtcaat gattgtggtc cagtacaagg gtgaagagaa gcagtttgca gctgaggaga
tctcttctat ggtcctcatc aagatgcgtg agattgctga agcttacctt ggcaccacca tAAAAAAAGC TGTCGTAACA
GTTCCTGCTT ACTTCAACTA CTCACAGAGG CAGGCTACCA AGGACGCTAG GGTCATTGCT GGCCTCAATG TCATGCGTAT
CATCAATGAG CCTACTGCTG CTGCCATTGC CTATGGTCTT GACAAGAAGG CTTCCAGTGT TGGTGAGAAG AACGTCCTCA
TCTTCGACCT TGGTGGTGGT ACCTTTGATG TCTCTCTTCT CACCATTGAG GAGGGAGGTC AAGGCCACAG CTGGTGACAC
GCATCTTGGT GGTGAGGACT TTGACAACAG AATGGTGAAG CACTTTGTTC AGGAGTTCAA GAGGAAGAGC AAGAAGGACA
TCACTGGCAA CCCAAGGCCT GTCGGGAGGC TGAGGACAGC TTGTGAGTGG GCGAAGAGGA CTCTCTCCCC TCCACTTCCC
AGACCACCCA CCATTGAGAT TGACTCCCTG TACGAGGGCA TCGACTTCTA CTCGAACATC ACCTGCGCCA GGTTCGAGGA
GCTGACCATG GATCTCTTCA GGAAGTGCAT GAGGGGATAC CAAGATGGAC AAAGAGCAGC GTGCACGATG TTCATCCTTG
TTGGTGGCTC CACCAGGATT CCCAGAGTGC AGCAGCTCCT CCAGGACTTC TTCAATGGCA AGGAGCTCTG CAAGAACATC
AACCCTGATG AGGCCGTCGC CTATGGCGCC GCTGTCCAGG CCCCCATCTT GGTCTGGAGA CGGCCAGAGG AGTGATGACC
TAGAAGGAGC AGGCCGGTCT TCTCCACCTA CTCCGACAAC CGGCCTGGTG TGTTGATCCA GGTGTACGAG GGCGATGGGA
GAGGACCATG ACACCATTGA GTAAGTGAGG AGATCGAGAA GATGGTCCAG GACGCGGAGA AGTACAAGTC GGAGGACGAT
GAGCTACATC GAAGAACATG CACAAACACC ATCAAGGTCC GAGCACCCAC GCGGCGGCCA AGAAGATGGG AGGACGCGGT
GGGAGATTGA GCCAAGATGG ACGAGGACGT GCCGTTAAAT TTTGGCTGAT CATGGTGGTT AAATTTTGGC TACGTTGTAA
TGAAAAATGC ATTGGTTGCT TCGTTAAAGT AATAGTACTA CAATTGTTCT GTTTCGGTTC ATCCGCATTT GCCTTTTGAT
TTTTGTTTAG CTGCTACTTA AATCGCGTTT ATTTTGCATA CAGTATCTAT CTGTCTTCTC CAAAGCGTTG GGGTGTGCTT
TTCTTCCCCG GTGGTATTCA CTATTCAGAG TCTTTTGTCG TCGTGTCTGC TCTAATATGC CATCCATTGT AGGGAGTGGA
TTACGTCCCC CCATCGTGTA TCTTTTTCTT TCAAAATCAA TGCAAATAGT TGTTAAAAAT TCTG

Locus: Os12g0569700

Loading...

Locus: Os12g0569700

Loading...