Os12t0569700-03

Locus

Os12g0569700

Description

Similar to Heat shock protein 70.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HSP23.7

CGSNL Gene Name

23.7 KDA HEAT SHOCK PROTEIN

Oryzabase Gene Symbol Synonym(s)

OsHsp23.7, OsHSP23.7

Oryzabase Gene Name Synonym(s)

23.7 kDa heat shock protein

Transcript Evidence

AK060051 (DDBJ, Best hit)

Protein Evidence

Q40693 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Heat shock protein Hsp70 (IPR001023)

Heat shock protein 70 (IPR013126)

Full-length cDNA

006-305-A04 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0569700-03)

Others

Oryzabase (10375)

Transcript

1003 bp

>Os12t0569700-03 Similar to Heat shock protein 70.
TGCGTATCATCAATGAGCCTACTGCTGCTGCCATTGCCTATGGTCTTGACAAGAAGGCTT
CCAGTGTTGGTGAGAAGAACGTCCTCATCTTCGACCTTGGTGGTGGTACCTTTGATGTCT
CTCTTCTCACCATTGAGGAGGGAGGTCAAGGCCACAGCTGGTGACACGCATCTTGGTGGT
GAGGACTTTGACAACAGAATGGTGAAGCACTTTGTTCAGGAGTTCAAGAGGAAGAGCAAG
AAGGACATCACTGGCAACCCAAGGCCTGTCGGGAGGCTGAGGACAGCTTGTGAGTGGGCG
AAGAGGACTCTCTCCCCTCCACTTCCCAGACCACCCACCATTGAGATTGACTCCCTGTAC
GAGGGCATCGACTTCTACTCGAACATCACCTGCGCCAGGTTCGAGGAGCTGACCATGGAT
CTCTTCAGGAAGTGCATGAGGGGATACCAAGATGGACAAAGAGCAGCGTGCACGATGTTC
ATCCTTGTTGGTGGCTCCACCAGGATTCCCAGAGTGCAGCAGCTCCTCCAGGACTTCTTC
AATGGCAAGGAGCTCTGCAAGAACATCAACCCTGATGAGGCCGTCGCCTATGGCGCCGCT
GTCCAGGCCCCCATCTTGGTCTGGAGACGGCCAGAGGAGTGATGACCTAGAAGGAGCAGG
CCGGTCTTCTCCACCTACTCCGACAACCGGCCTGGTGTGTTGATCCAGGTGTACGAGGGC
GATGGGAGAGGACCATGACACCATTGAGTAAGTGAGGAGATCGAGAAGATGGTCCAGGAC
GCGGAGAAGTACAAGTCGGAGGACGATGAGCTACATCGAAGAACATGCACAAACACCATC
AAGGTCCGAGCACCCACGCGGCGGCCAAGAAGATGGGAGGACGCGGTGGGAGATTGAGCC
AAGATGGACGAGGACGTGCCGTTAAATTTTGGCTGATCATGGTGGTTAAATTTTGGCTAC
GTTGTAATGAAAAATGCATTGGTTGCTTCGTTAAAGTAATAGT

CDS

630 bp

>Os12t0569700-03 Similar to Heat shock protein 70.
ATGAGCCTACTGCTGCTGCCATTGCCTATGGTCTTGACAAGAAGGCTTCCAGTGTTGGTG
AGAAGAACGTCCTCATCTTCGACCTTGGTGGTGGTACCTTTGATGTCTCTCTTCTCACCA
TTGAGGAGGGAGGTCAAGGCCACAGCTGGTGACACGCATCTTGGTGGTGAGGACTTTGAC
AACAGAATGGTGAAGCACTTTGTTCAGGAGTTCAAGAGGAAGAGCAAGAAGGACATCACT
GGCAACCCAAGGCCTGTCGGGAGGCTGAGGACAGCTTGTGAGTGGGCGAAGAGGACTCTC
TCCCCTCCACTTCCCAGACCACCCACCATTGAGATTGACTCCCTGTACGAGGGCATCGAC
TTCTACTCGAACATCACCTGCGCCAGGTTCGAGGAGCTGACCATGGATCTCTTCAGGAAG
TGCATGAGGGGATACCAAGATGGACAAAGAGCAGCGTGCACGATGTTCATCCTTGTTGGT
GGCTCCACCAGGATTCCCAGAGTGCAGCAGCTCCTCCAGGACTTCTTCAATGGCAAGGAG
CTCTGCAAGAACATCAACCCTGATGAGGCCGTCGCCTATGGCGCCGCTGTCCAGGCCCCC
ATCTTGGTCTGGAGACGGCCAGAGGAGTGA

Protein

209 aa

>Os12t0569700-03 Similar to Heat shock protein 70.
MSLLLLPLPMVLTRRLPVLVRRTSSSSTLVVVPLMSLFSPLRREVKATAGDTHLGGEDFD
NRMVKHFVQEFKRKSKKDITGNPRPVGRLRTACEWAKRTLSPPLPRPPTIEIDSLYEGID
FYSNITCARFEELTMDLFRKCMRGYQDGQRAACTMFILVGGSTRIPRVQQLLQDFFNGKE
LCKNINPDEAVAYGAAVQAPILVWRRPEE*

5'UTR

chr12:23445924..23445935 (+ strand) : 12 bp

CDS

chr12:23445936..23446565 (+ strand) : 630 bp

3'UTR

chr12:23446566..23446926 (+ strand) : 361 bp

FASTA

>Os12t0569700-03 class=Sequence position=chr12:23445924..23446926 (+ strand)
TGCGTATCAT CAATGAGCCT ACTGCTGCTG CCATTGCCTA TGGTCTTGAC AAGAAGGCTT CCAGTGTTGG TGAGAAGAAC
GTCCTCATCT TCGACCTTGG TGGTGGTACC TTTGATGTCT CTCTTCTCAC CATTGAGGAG GGAGGTCAAG GCCACAGCTG
GTGACACGCA TCTTGGTGGT GAGGACTTTG ACAACAGAAT GGTGAAGCAC TTTGTTCAGG AGTTCAAGAG GAAGAGCAAG
AAGGACATCA CTGGCAACCC AAGGCCTGTC GGGAGGCTGA GGACAGCTTG TGAGTGGGCG AAGAGGACTC TCTCCCCTCC
ACTTCCCAGA CCACCCACCA TTGAGATTGA CTCCCTGTAC GAGGGCATCG ACTTCTACTC GAACATCACC TGCGCCAGGT
TCGAGGAGCT GACCATGGAT CTCTTCAGGA AGTGCATGAG GGGATACCAA GATGGACAAA GAGCAGCGTG CACGATGTTC
ATCCTTGTTG GTGGCTCCAC CAGGATTCCC AGAGTGCAGC AGCTCCTCCA GGACTTCTTC AATGGCAAGG AGCTCTGCAA
GAACATCAAC CCTGATGAGG CCGTCGCCTA TGGCGCCGCT GTCCAGGCCC CCATCTTGGT CTGGAGACGG CCAGAGGAGT
GATGACCTAG AAGGAGCAGG CCGGTCTTCT CCACCTACTC CGACAACCGG CCTGGTGTGT TGATCCAGGT GTACGAGGGC
GATGGGAGAG GACCATGACA CCATTGAGTA AGTGAGGAGA TCGAGAAGAT GGTCCAGGAC GCGGAGAAGT ACAAGTCGGA
GGACGATGAG CTACATCGAA GAACATGCAC AAACACCATC AAGGTCCGAG CACCCACGCG GCGGCCAAGA AGATGGGAGG
ACGCGGTGGG AGATTGAGCC AAGATGGACG AGGACGTGCC GTTAAATTTT GGCTGATCAT GGTGGTTAAA TTTTGGCTAC
GTTGTAATGA AAAATGCATT GGTTGCTTCG TTAAAGTAAT AGT

Locus: Os12g0569700

Loading...

Locus: Os12g0569700

Loading...