Os12t0572000-01

Locus

Os12g0572000

Description

R2R3-type MYB transcription factor, Adaptive growth, Salt tolerance

RAP-DB Gene Symbol Synonym(s)

OsMYB91, OsRS2

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsMYB91, MYB91, OsRS2, RS2

Oryzabase Gene Name Synonym(s)

ROUGH SHEATH2, ROUGH SHEATH 2

Transcript Evidence

AB064519

Protein Evidence

Q94IB1

F4MGP4

Literature

PMID: 26025528

Note

Manual Curation

June 5, 2015

Gene Ontology (GO)

Biological Process: transcription, DNA-templated (GO:0006351)

Biological Process: leaf formation (GO:0010338)

Molecular Function: DNA binding (GO:0003677)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Protein rough sheath 2/ASYMMETRIC LEAVES1 (IPR031055)

Homeodomain-like (IPR009057)

SANT/Myb domain (IPR001005)

Myb domain (IPR017930)

Expression Databases

TENOR (Os12t0572000-00)

Others

Oryzabase (19892)

Transcript

1693 bp

>Os12t0572000-01 R2R3-type MYB transcription factor, Adaptive growth, Salt tolerance
CTTTTCCTCTCCTCCTCCCGTCTTTTCCACCACCACCACCCTCGCGTGCCCTAATTTCTC
GCTGCTCCTTGTCCCCCACCTCCTTTACTTGAGCTTGCTCACCACTGCCTCCATATACAG
AGAGTCTTCTCTGTATTTCTCTCTCTCAGTGGGAGGCTCACAAGAATCTTTCAGCTCACA
TCTCACTGTCCTTGCCTTTCTCTAGCTAGGTACTACTACTGCTAGTACTAACCACTGCTC
GTGTTCTTGGGACTTCTTCTTCTTCTTGTTCTTGTTCTTAAAATCATTTGGGGTTTTGAG
CTCCAGGGAGGTCCAAGAACAGAGCAGCAGGATGGTGCAGTGGCGTTTCTGAGAGCAGCA
TGAGTACTCGCACCACCGAGCTGGGATGGTCGGCGATGGCGAACACCGATGCAGCCGCCG
CCGATGAGGGAGAGGCAGCGGTGGCGGCCTGAGGAAGACGCCATCCTCCTCGCCTACGTC
CGCCAGTATGGGCCCCGGGAGTGGAGCCTCGTGTCCCAGCGGATGAACCGCCCCCTCCAC
CGCGACGCCAAGTCCTGCCTCGAGCGCTGGAAGAACTACCTCCGCCCGGGGATCAAGAAA
GGTTCGCTCACCGACGACGAGCAGCGCCTCGTCATCCGCCTCCAGGCCAAGCACGGCAAC
AAGTGGAAGAAGATCGCCGCCGAGGTCCCCGGCCGGACGGCGAAGCGGCTGGGCAAGTGG
TGGGAGGTGTTCAAGGAGAAGCAGCAGCGGGAGCTCCGGGATCGGGATCGCCGGCGACTC
CCGCCGCCGCTGGACGGCGACGAGCGCGGCTGCGCCGGCGGGCGATACGACTGGCTCCTC
GAGGACTTCGCCGACAAGCTCGTCAACGACCACCACCGCCGAATGATGGCTGCCCCGATC
CTCCCGCCGTGGATGTCGTCGTCGCCGTCGTCTTCTTCCTCGCCGTCGGTGACGCTTAGC
CTCGCGTCGGCGGCGGTGGCGCCGGCGCCTGCGGCGCCGCCGCCGACGTGGGGTGGTGGT
GGAGGAGGGGAGGTGGTGGTGGCGGAGTTGATGGAGTGTTGCAGGGAGATGGAGGAAGGG
CAGAGGGCGTGGGCGGCGCACAGGAAGGAGGCGGCGTGGAGGATGAAGAGGGTGGAGATG
CAGCTGGAGACGGAGAGGGCGTGCCGGCGGCGGGAGGCGACGGAGGAGTTCGAGGCGAAG
ATGAGGGCGCTGAGGGAGGAGCAGGCAGCTGCGGTGGAGCGGGTGGAGGCGGAGTACCGG
GAGAAGATGGCCGGCCTCCGCCGCGACGCGGAGGCCAAGGAGCAGAAGATGGCGGAGCAG
TGGGCGGCCAAGCACGCCCGCCTCGCCAAGTTCCTCGACCAGGTCGCCGCCTGCCGCCGC
TGGCCGCCCGTAGAGATCAACGGCGGCGGCGGCGGCGGCCCCGGCGGCGGCCGGTGAGCC
GCCGGACGGTGGCGCTGCATGCATGCGTAGTTGGACACCTCGCTTTCTTGCTTCTTCTTC
TCGTGTCCTTTTTACAACTGTTGGAATTCACTTCTCTCTAGAAATATGTAATCTTTTGAG
TCTCTTTTGATCATTCCAAGTTTCCTACTAGTAGCTCTATTGAATAATAAATGGACCACC
AAATTGCAAACCAAAATGGTTACAAAAGAATATCTTGAGCAGCAGTAGATTGCAATGGAA
ATAAGTTTTTTTA

CDS

1029 bp

>Os12t0572000-01 R2R3-type MYB transcription factor, Adaptive growth, Salt tolerance
ATGCAGCCGCCGCCGATGAGGGAGAGGCAGCGGTGGCGGCCTGAGGAAGACGCCATCCTC
CTCGCCTACGTCCGCCAGTATGGGCCCCGGGAGTGGAGCCTCGTGTCCCAGCGGATGAAC
CGCCCCCTCCACCGCGACGCCAAGTCCTGCCTCGAGCGCTGGAAGAACTACCTCCGCCCG
GGGATCAAGAAAGGTTCGCTCACCGACGACGAGCAGCGCCTCGTCATCCGCCTCCAGGCC
AAGCACGGCAACAAGTGGAAGAAGATCGCCGCCGAGGTCCCCGGCCGGACGGCGAAGCGG
CTGGGCAAGTGGTGGGAGGTGTTCAAGGAGAAGCAGCAGCGGGAGCTCCGGGATCGGGAT
CGCCGGCGACTCCCGCCGCCGCTGGACGGCGACGAGCGCGGCTGCGCCGGCGGGCGATAC
GACTGGCTCCTCGAGGACTTCGCCGACAAGCTCGTCAACGACCACCACCGCCGAATGATG
GCTGCCCCGATCCTCCCGCCGTGGATGTCGTCGTCGCCGTCGTCTTCTTCCTCGCCGTCG
GTGACGCTTAGCCTCGCGTCGGCGGCGGTGGCGCCGGCGCCTGCGGCGCCGCCGCCGACG
TGGGGTGGTGGTGGAGGAGGGGAGGTGGTGGTGGCGGAGTTGATGGAGTGTTGCAGGGAG
ATGGAGGAAGGGCAGAGGGCGTGGGCGGCGCACAGGAAGGAGGCGGCGTGGAGGATGAAG
AGGGTGGAGATGCAGCTGGAGACGGAGAGGGCGTGCCGGCGGCGGGAGGCGACGGAGGAG
TTCGAGGCGAAGATGAGGGCGCTGAGGGAGGAGCAGGCAGCTGCGGTGGAGCGGGTGGAG
GCGGAGTACCGGGAGAAGATGGCCGGCCTCCGCCGCGACGCGGAGGCCAAGGAGCAGAAG
ATGGCGGAGCAGTGGGCGGCCAAGCACGCCCGCCTCGCCAAGTTCCTCGACCAGGTCGCC
GCCTGCCGCCGCTGGCCGCCCGTAGAGATCAACGGCGGCGGCGGCGGCGGCCCCGGCGGC
GGCCGGTGA

Protein

343 aa

>Os12t0572000-01 R2R3-type MYB transcription factor, Adaptive growth, Salt tolerance
MQPPPMRERQRWRPEEDAILLAYVRQYGPREWSLVSQRMNRPLHRDAKSCLERWKNYLRP
GIKKGSLTDDEQRLVIRLQAKHGNKWKKIAAEVPGRTAKRLGKWWEVFKEKQQRELRDRD
RRRLPPPLDGDERGCAGGRYDWLLEDFADKLVNDHHRRMMAAPILPPWMSSSPSSSSSPS
VTLSLASAAVAPAPAAPPPTWGGGGGGEVVVAELMECCREMEEGQRAWAAHRKEAAWRMK
RVEMQLETERACRRREATEEFEAKMRALREEQAAAVERVEAEYREKMAGLRRDAEAKEQK
MAEQWAAKHARLAKFLDQVAACRRWPPVEINGGGGGGPGGGR*

5'UTR

chr12:23560202..23560551 (- strand) : 350 bp

chr12:23556562..23556619 (- strand) : 58 bp

CDS

chr12:23555906..23556561 (- strand) : 656 bp

chr12:23555184..23555556 (- strand) : 373 bp

3'UTR

chr12:23554928..23555183 (- strand) : 256 bp

FASTA

>Os12t0572000-01 class=Sequence position=chr12:23554928..23560551 (- strand)
CTTTTCCTCT CCTCCTCCCG TCTTTTCCAC CACCACCACC CTCGCGTGCC CTAATTTCTC GCTGCTCCTT GTCCCCCACC
TCCTTTACTT GAGCTTGCTC ACCACTGCCT CCATATACAG AGAGTCTTCT CTGTATTTCT CTCTCTCAGT GGGAGGCTCA
CAAGAATCTT TCAGCTCACA TCTCACTGTC CTTGCCTTTC TCTAGCTAGG TACTACTACT GCTAGTACTA ACCACTGCTC
GTGTTCTTGG GACTTCTTCT TCTTCTTGTT CTTGTTCTTA AAATCATTTG GGGTTTTGAG CTCCAGGGAG GTCCAAGAAC
AGAGCAGCAG GATGGTGCAG TGGCGTTTCT GTAAGTGAAT CCTACTACCT TCAGTTTCTT GAGCAGTTTC AGTAGTGTAG
AGCTTATGAT GTAATGCAGC AGGTGCCATG TGTGTTGTGC TCTGAAGAAA GCTGTTCTGT GGGTTGCTTT GTTACTATGT
TTTTTGTGTT CATGTTTCTT GGTCTGTATG GCTCTACATG TTGGGTGTTT TTGGTCAGAT TTTGTCTCTC CTATATCTGC
TAGTCTGTTT TTCTGCAATA GATCTTTCTG TTAGATTTCT TGTCTTGTAG GGAAGTTGGT AGAGGATGTG CTCTCAGGGT
AAGGATTGAT TGTCAGTTTG CTTAGTTCTT TCTTTTGATT CACCAGTTGG GATTTAGTTA GTATGGATAG ATAATCTGCT
AGGTTGGGGT TAAATGTTGC CTCTGATATG GTGAGTGAAA CTACTTTTGT GGATTTTGTA TGGATTGTGG TTAGTGGGTG
AAATTTGTGT TCTTGATTGA AACATCTACC TAGTTCTTGA ATCTTCAATG GCAGCATTAT TGTACTGATT GTTGTATGGT
CCAATAATGT ATTTAGGGGG ATTCTACTTA CTGCTAGTCT GCTCCCAGAT ATGAAGATTT GATTCTGTTT TTTTTCCTCT
TCAAATGTTT CTTTTTTATA ATTAGTTGAA ATATGCTATT ATCCAGAGTA CTTTTGGGGG TTTATGGATT GTTTCCTCCT
ACTCAAGAGA GGTAAACAAA GTAACTTCTT CAGTACAGAT TTTCCAGAGA TGCCATTTCT TCTTCATCAT TCCTCCTTTG
ATTACTTCAT GATTGTTTTT ACCTGCTTCT CAGCCCATAT CCCTTGGAAC ATTCACTTCC ATGAAAATTA CCACCTAAGG
AAAAAAAAAC AAAATGGTCA GTAATTGAGA ACTTGCTATA TTAGTTACCT GAAAGATAGT AACACCCAGC AACACAGATC
CATGTTTCAG TATACTTGTG GTATAGGAGT AGTATAGTAT AGTATACCCC CACACTGCTT TCAATTTGTC AGTACTACTA
CTGTGGTAGT AACATCTAGC CAAGGAGGAT ACAACGGTCC AATCCAATCA GATCAACAAA CAACAACACA TTGATTTCTT
TGGCCTACTA CCATGCTTTC AACATTCTTT CATTTTGTTT CTTCTTGGTT AATGCTTGAA TTTCTAGATG AAATGGATGG
CACAAGACCA CTCTTGAGGA ATCCTAAGTT TCCTATAAAT CCCTTTTATA AATACTTTTT TTTAGAAACA ACTGTTTTGT
CTCAACTTAA AAAAAATAAA ATCAAAAGCA TATTGCTTGC AAGAATTCAG AAGATGTTCT AGGTGAAATT CTTGCAGATT
TTATTGCATT TCTCTCTCAT GAGTCCTTCA TTACAATTAG GTGAAAACTA AAGAGGTGCC ATATTAAATA GAGTGAATTT
ATTGCAAATT AAATTGGTTT TCGATTTGTC AAATTTGCTC GAGACACCTA ACCAACTAAC CCTTATTGTC CAAATCAAAA
TTCCATCTCG TGCGCAATTA GCCCTGGCCA TAGCTTTAAT TCGTCATTAG TAGGCAACCA GTGGGGGCTC CAAATGGTCC
TAGAATCATC ACTTTTACTT TGGATTTGCT TCTGCCTCTT GCACATTCCC TTATTTTGTA GCCTTCTTGA GGGTATTAGG
TAGGTGTTTT GGCAGATTAT CTCCCCATTG ATCAGCTCCC AATTAATGCC AGATGGTGAC ACTGCTAAAG ATGGAAGACA
AGCTTGCGAG AAAACAGTGG TAGCCTTATT ATTTCCTCTC ACAAGAATTG TGCCCACAAC TTGTCCTGAC ATCTGTGAAT
TTGTCTGTAT GTTGATAGTA ATAGCTGGAT GAATCATGGG TGCTTAACAA TGCTCTTACT TACCAATAGT GTTTATGGTC
GGTTGGCCCT TGCAACCTCC AAAGAACCAA TTGGAGCAAT TCAGCCTTCT CTTTTTTTTT TCTCTCTCTG TCATTTTCTG
TGCTTTAACT GTTATCTGAA CGAGTAGTTA ACTGTATAAT GTCAAAGGAA TAATCTTGCA CAAATTTAGT ACCAATGTTG
TTGTAGAGGA GCATGTATAA GCTTTATCTG TGGTACTGTG GTAGTAAGTA GGATGTGTAG AGTGTGCAGG TCACAGTTAT
GGATCACTGA ACAAATAAAT TAACTCCCCT GCTTTTGACA CCCCAAACTG AAACATATAA ATGCTGCAAT GAATAAAGCA
ACTAACTTTA CACTATCACA GCCCTAGCTT CTGTTCTGGC CAGTTTCTTG CTCCCTCCAG ACGGTAATCA CTTTACTCTG
TATCAACATT TGCATTTAAA CTGGTTGTGG TTGACTGGTT GTTTGACTAG ATTAGCACAA CTAGAAACCA TGCCAAGCCA
TTCCTGATCT GCAGTGTGTC GTTTCTTTCT TCTGAACTGA AGATTTGATC TTTTCTGTTT GCAAAGTTCA TGCTTACACA
CTTACTACAC TTGAAATCTG TAAGATAAGT GCTCTACATT GAACTAAAAA TACGTAAATT TTTTGTACAT GATCTGATTT
CTCATGTGCT TGTTTTCCTC TTAGCTAATG ACTTTTATCT TTTCTGTTGT AGAAATTAGA ATCCATGCTC ATTTACCATT
GTAAGATGAA ATCCTACATT GAGCCAAAAA TCTAACTTTC TTTTCTTTTT GTTTGTACAT GACCTCGTCC TCTATTTGGA
TGAAGATTTC ACCTTTGCTA CTAATAGACG AGCCTTGCAA ACAGGCTAAA GAAATGATCT TTTTTTTTTA TTTgagtaaa
tttcagaaat ctacaactat ttgggtcaaa actatcaatt tgctacaCGT CATACTCATG CATACATGCC AAGTTCACAC
GCACGCACAA CTGGTTACAG TTGCAGAACT TGCAGTTTAA TGATAAAATC GTTTGATATA GTTACAACAG TTTTGCGAAA
TGTTCGCCTT AATCTTATAG AAAAGCGATA CCTTTGACCA AATAACTACA GCTTTCTGAA ATTTACTCCT TTATATATAT
TTTGCATCAC GAGAAACAAT TTTAATCACT TAGGTGGATA TCTACTCATT TGTTGCATGT GAACAAAATG AATATGaaaa
aaaaaataaa aagaataatt aatacacgta tattcacaga tgaatttgtt ttttttgtta taacttgtat atttcatatt
aatctatctc gttaattttt ttatattatt tatttgacat gcaataaatg gacgaacatc cacccgagcg attacaatcc
TCtccaccaa catacaagtt taaattcaac ttctataaat tgtaacaaaa ataacaaatt taactccaat aagtatatgc
atattcacaa atgaatttat taattttgtt ataacttgta gaagtcgaat ttaaaattgc atgtttgtgg ggtgatatat
ttcatattaa tctatcttat caacttttct gaattttttt tcaataaacg ggcgaacatc caaccgagcg attacaatcc
TCTCTCTTGG TAGCTAACTA AAGAAGTGAT CTTCTTCTTC TTCTTCTTCA TCTTGCATGA CTTCTCACGA CAATGGCGGC
GCGCGGGTGC AGGAGAGCAG CATGAGTACT CGCACCACCG AGCTGGGATG GTCGGCGATG GCGAACACCG ATGCAGCCGC
CGCCGATGAG GGAGAGGCAG CGGTGGCGGC CTGAGGAAGA CGCCATCCTC CTCGCCTACG TCCGCCAGTA TGGGCCCCGG
GAGTGGAGCC TCGTGTCCCA GCGGATGAAC CGCCCCCTCC ACCGCGACGC CAAGTCCTGC CTCGAGCGCT GGAAGAACTA
CCTCCGCCCG GGGATCAAGA AAGGTTCGCT CACCGACGAC GAGCAGCGCC TCGTCATCCG CCTCCAGGCC AAGCACGGCA
ACAAGTGGAA GAAGATCGCC GCCGAGGTCC CCGGCCGGAC GGCGAAGCGG CTGGGCAAGT GGTGGGAGGT GTTCAAGGAG
AAGCAGCAGC GGGAGCTCCG GGATCGGGAT CGCCGGCGAC TCCCGCCGCC GCTGGACGGC GACGAGCGCG GCTGCGCCGG
CGGGCGATAC GACTGGCTCC TCGAGGACTT CGCCGACAAG CTCGTCAACG ACCACCACCG CCGAATGATG GCTGCCCCGA
TCCTCCCGCC GTGGATGTCG TCGTCGCCGT CGTCTTCTTC CTCGCCGTCG GTGACGCTTA GCCTCGCGTC GGCGGCGGTG
GCGCCGGCGC CTGCGGCGCC GCCGCCGACG TGGGGTGGTG GTGGAGGAGG GGAGGTGGTG GTGGCGGAGT TGATGGAGTG
TTGCAGGTGC TTGAAATCTT TTGctcccta cgtttttaaa tatttaatac tctttgattt ttctaaaaaa aaatatttaa
ccgctcattt tattttttaa aaaattaatt attaattttg ttcctatcat ttcattcatt tacttatatt tattaaatat
acttatatgt atactacata tagttttaca tatttcacaa aaatttttaa taaaacaaat atttaaacat ataattaaaa
agttaacggc gttaaatGGG GGATTTCTTC ATCTCATTCG TCTTCTTTGA CCCACTATCA TCGATTGGAT CTCCTCTTTT
ATGTGTCGTC GCTTGACTCG CATCTATTGT TGCAGGGAGA TGGAGGAAGG GCAGAGGGCG TGGGCGGCGC ACAGGAAGGA
GGCGGCGTGG AGGATGAAGA GGGTGGAGAT GCAGCTGGAG ACGGAGAGGG CGTGCCGGCG GCGGGAGGCG ACGGAGGAGT
TCGAGGCGAA GATGAGGGCG CTGAGGGAGG AGCAGGCAGC TGCGGTGGAG CGGGTGGAGG CGGAGTACCG GGAGAAGATG
GCCGGCCTCC GCCGCGACGC GGAGGCCAAG GAGCAGAAGA TGGCGGAGCA GTGGGCGGCC AAGCACGCCC GCCTCGCCAA
GTTCCTCGAC CAGGTCGCCG CCTGCCGCCG CTGGCCGCCC GTAGAGATCA ACGGCGGCGG CGGCGGCGGC CCCGGCGGCG
GCCGGTGAGC CGCCGGACGG TGGCGCTGCA TGCATGCGTA GTTGGACACC TCGCTTTCTT GCTTCTTCTT CTCGTGTCCT
TTTTACAACT GTTGGAATTC ACTTCTCTCT AGAAATATGT AATCTTTTGA GTCTCTTTTG ATCATTCCAA GTTTCCTACT
AGTAGCTCTA TTGAATAATA AATGGACCAC CAAATTGCAA ACCAAAATGG TTACAAAAGA ATATCTTGAG CAGCAGTAGA
TTGCAATGGA AATAAGTTTT TTTA