Os12t0576700-01

Locus

Os12g0576700

Description

Similar to Diphosphonucleotide phosphatase 1 precursor.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PAP1C

CGSNL Gene Name

PURPLE ACID PHOSPHATASE 1C

Oryzabase Gene Symbol Synonym(s)

OsPAP1c, NPP4, OsNPP4

Oryzabase Gene Name Synonym(s)

purple acid phosphatase 1c, Nucleotide pyrophosphatase/phosphodiesterase 4

Transcript Evidence

AK073512 (DDBJ, Best hit)

Protein Evidence

NP_001152048.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: acid phosphatase activity (GO:0003993)

Molecular Function: hydrolase activity (GO:0016787)

Molecular Function: metal ion binding (GO:0046872)

Functional domain (InterPro)

Metallophosphoesterase domain (IPR004843)

Purple acid phosphatase-like, N-terminal (IPR008963)

Purple acid phosphatase, N-terminal (IPR015914)

Full-length cDNA

J033043B10 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0576700-01)

RiceXPro (AK073512)

Others

Oryzabase (11374)

KEGG (Os12t0576700-01)

Transcript

2018 bp

>Os12t0576700-01 Similar to Diphosphonucleotide phosphatase 1 precursor.
AAGGAGTTCTTGAAGTTGCTACCTTTTACTTGGTCTCTGAAGGAGGAGTATGATCAGGCT
GTGGGTGGTGGTCACATGGCTGGTTCTTTGGGCCGCAGCTGCGGTGCACCCCGGGGAGCA
GCCGCTGTCGAGGATTGCCGTCGAGAGGATGGTCCTTGCCGTCAACGAGTCGGCACATGT
CAGGGCGTCCCCTTTGGTTCTTGGGCTGAAGGGTGAGACCAATGAATGGGTAGAGGTAGA
GTTCTTCAATCCAAACCCCTCCAatactgactgggttggagtgttttctcctgctgattt
tagttctgcaatctgtgaggcttatggtgttccacagtattacccaatgctctgcacagc
acctatcaagtaccaatatgcaaacttcaataataatggttatagtaagtctgggaaggg
caaactgaagcttcagttgatcaaccagagggaggatttctcatttgctcttttttctgg
tggCCTCGAGAATCCAAAGCTGGTTGCTGTCTCAAACAAGATCGCATTTGCGAATCCGAA
GGCGCCTGTTTACCCACGTTTAGCTCAAGGGAAGTCTTGGAATGAAATGACAGTAACTTG
GACAAGTGGGTACGATTTTAAAGAAGCAGTTCCTTTCGTCGAATGGGGCGCGAAAGGGGG
ACAACGGGTCCTTTCTCCAGCTGGAACATTAACATTTGACAGAAATAGCATGTGTGGTGC
ACCGGCACGAACTGTCGGTTGGCGCCATCCTGGTTACATTCATACAAGCTACTTGAAAGA
ACTGTGGCCAGATTCACTGTATACTTACAGACTTGGCCATAGGTTACCAAATGGTACTCA
CATCTGGAGTAAGTCATACAGCTTCAAAGCATCACCTTATCCTGGGCAAGATTCCGTTCA
GAGAGTAGTCATATTTGGAGACATGGGAAAGgcagaggcagacggttcaaatgagttcaa
tgacttccagccaggatcattgaacactacttaccagatcatcagagacctgaaaaacat
tgacatggttgtccatattggggatatttgctatgcaaatggttacttgtcgcagtggga
tcagttcactgcgcagatcgagccaattgcttcgactgttccatacatgattggcatggg
taatcatgagagggattggcctggaactggttcattctatggaaaccttgactctggagg
agaatgtggtgttcctgctcaaactgtattctacactcctgctgagaaccgtgcaaaatt
atggtatgcgacagactatggcatgttcaggttctgcattgctaatacagaagaggactg
gaggccagggactgagcagtacaagttcatcgagcaatgcctatcgtccgtcgacaggca
gaagcagccatggctcatattccttgcgcaccgagttctcgggtactcatcctgcacctt
ttatgaagaagagggtacatttgaggaaccgatgggccgagaatcactacaggagctttg
gcagaagtacaaggttgaCCTCGCCTTCTATGGCCATGTCCACAACTATGAAAGAACATG
CCCAGTCTATCAGAATAAATGTGTTGTTAGTGGTTCAGATCATTACAGTGGTCCTTTCAC
CGCGACAACACATGTGGTCGTTGGAGGTGCTGGTGCTGGTACCTCCGACTCAGAATTCAC
CACTTCAAATATCAAATGGAGTTACTACAGGGACTTTGACTACGGTTTTGTCAAGCTCAC
AGCTTTAAATCATTCATCCTTATTGTTTGAGTACAAGAAAAGCAGTGACGGCAATGTGTA
TGATCATTTCACAATCTCACGTGATTACCGAGACATCCTGGCTTGTTCAATTGACAACTG
TCCTCGGACCACACTGGCTACCTAAAGCATGAACAGTTCTAGACAGGTTTACAGGTAGAT
TGATTGACAGGGCCTCAAAGAGCAATCTAGTTCCTGTACAAAGTCTTTTGGGACTATTCC
AATAAATCATAATAAACACGGAATTTTCTTGACTGCGT

CDS

1836 bp

>Os12t0576700-01 Similar to Diphosphonucleotide phosphatase 1 precursor.
ATGATCAGGCTGTGGGTGGTGGTCACATGGCTGGTTCTTTGGGCCGCAGCTGCGGTGCAC
CCCGGGGAGCAGCCGCTGTCGAGGATTGCCGTCGAGAGGATGGTCCTTGCCGTCAACGAG
TCGGCACATGTCAGGGCGTCCCCTTTGGTTCTTGGGCTGAAGGGTGAGACCAATGAATGG
GTAGAGGTAGAGTTCTTCAATCCAAACCCCTCCAatactgactgggttggagtgttttct
cctgctgattttagttctgcaatctgtgaggcttatggtgttccacagtattacccaatg
ctctgcacagcacctatcaagtaccaatatgcaaacttcaataataatggttatagtaag
tctgggaagggcaaactgaagcttcagttgatcaaccagagggaggatttctcatttgct
cttttttctggtggCCTCGAGAATCCAAAGCTGGTTGCTGTCTCAAACAAGATCGCATTT
GCGAATCCGAAGGCGCCTGTTTACCCACGTTTAGCTCAAGGGAAGTCTTGGAATGAAATG
ACAGTAACTTGGACAAGTGGGTACGATTTTAAAGAAGCAGTTCCTTTCGTCGAATGGGGC
GCGAAAGGGGGACAACGGGTCCTTTCTCCAGCTGGAACATTAACATTTGACAGAAATAGC
ATGTGTGGTGCACCGGCACGAACTGTCGGTTGGCGCCATCCTGGTTACATTCATACAAGC
TACTTGAAAGAACTGTGGCCAGATTCACTGTATACTTACAGACTTGGCCATAGGTTACCA
AATGGTACTCACATCTGGAGTAAGTCATACAGCTTCAAAGCATCACCTTATCCTGGGCAA
GATTCCGTTCAGAGAGTAGTCATATTTGGAGACATGGGAAAGgcagaggcagacggttca
aatgagttcaatgacttccagccaggatcattgaacactacttaccagatcatcagagac
ctgaaaaacattgacatggttgtccatattggggatatttgctatgcaaatggttacttg
tcgcagtgggatcagttcactgcgcagatcgagccaattgcttcgactgttccatacatg
attggcatgggtaatcatgagagggattggcctggaactggttcattctatggaaacctt
gactctggaggagaatgtggtgttcctgctcaaactgtattctacactcctgctgagaac
cgtgcaaaattatggtatgcgacagactatggcatgttcaggttctgcattgctaataca
gaagaggactggaggccagggactgagcagtacaagttcatcgagcaatgcctatcgtcc
gtcgacaggcagaagcagccatggctcatattccttgcgcaccgagttctcgggtactca
tcctgcaccttttatgaagaagagggtacatttgaggaaccgatgggccgagaatcacta
caggagctttggcagaagtacaaggttgaCCTCGCCTTCTATGGCCATGTCCACAACTAT
GAAAGAACATGCCCAGTCTATCAGAATAAATGTGTTGTTAGTGGTTCAGATCATTACAGT
GGTCCTTTCACCGCGACAACACATGTGGTCGTTGGAGGTGCTGGTGCTGGTACCTCCGAC
TCAGAATTCACCACTTCAAATATCAAATGGAGTTACTACAGGGACTTTGACTACGGTTTT
GTCAAGCTCACAGCTTTAAATCATTCATCCTTATTGTTTGAGTACAAGAAAAGCAGTGAC
GGCAATGTGTATGATCATTTCACAATCTCACGTGATTACCGAGACATCCTGGCTTGTTCA
ATTGACAACTGTCCTCGGACCACACTGGCTACCTAA

Protein

612 aa

>Os12t0576700-01 Similar to Diphosphonucleotide phosphatase 1 precursor.
MIRLWVVVTWLVLWAAAAVHPGEQPLSRIAVERMVLAVNESAHVRASPLVLGLKGETNEW
VEVEFFNPNPSNTDWVGVFSPADFSSAICEAYGVPQYYPMLCTAPIKYQYANFNNNGYSK
SGKGKLKLQLINQREDFSFALFSGGLENPKLVAVSNKIAFANPKAPVYPRLAQGKSWNEM
TVTWTSGYDFKEAVPFVEWGAKGGQRVLSPAGTLTFDRNSMCGAPARTVGWRHPGYIHTS
YLKELWPDSLYTYRLGHRLPNGTHIWSKSYSFKASPYPGQDSVQRVVIFGDMGKAEADGS
NEFNDFQPGSLNTTYQIIRDLKNIDMVVHIGDICYANGYLSQWDQFTAQIEPIASTVPYM
IGMGNHERDWPGTGSFYGNLDSGGECGVPAQTVFYTPAENRAKLWYATDYGMFRFCIANT
EEDWRPGTEQYKFIEQCLSSVDRQKQPWLIFLAHRVLGYSSCTFYEEEGTFEEPMGRESL
QELWQKYKVDLAFYGHVHNYERTCPVYQNKCVVSGSDHYSGPFTATTHVVVGGAGAGTSD
SEFTTSNIKWSYYRDFDYGFVKLTALNHSSLLFEYKKSSDGNVYDHFTISRDYRDILACS
IDNCPRTTLAT*

5'UTR

chr12:23814332..23814363 (- strand) : 32 bp

chr12:23814202..23814218 (- strand) : 17 bp

CDS

chr12:23814040..23814201 (- strand) : 162 bp

chr12:23813846..23813937 (- strand) : 92 bp

chr12:23813691..23813757 (- strand) : 67 bp

chr12:23813447..23813569 (- strand) : 123 bp

chr12:23813229..23813321 (- strand) : 93 bp

chr12:23812941..23813070 (- strand) : 130 bp

chr12:23812418..23812499 (- strand) : 82 bp

chr12:23812205..23812337 (- strand) : 133 bp

chr12:23811895..23812100 (- strand) : 206 bp

chr12:23811695..23811820 (- strand) : 126 bp

chr12:23811297..23811606 (- strand) : 310 bp

chr12:23810751..23811062 (- strand) : 312 bp

3'UTR

chr12:23810618..23810750 (- strand) : 133 bp

FASTA

>Os12t0576700-01 class=Sequence position=chr12:23810618..23814363 (- strand)
AAGGAGTTCT TGAAGTTGCT ACCTTTTACT TGGTGCCTTG CTCTCTCTTT CTTGGAGATT GCTGCCGTCT ATAAGGAATT
TCAGATAGGA GGTGGATTCC AGGCTAAGTT CATCACTGAC TCTGGCTGGG TAATTTTTTT TTCAGGTCTC TGAAGGAGGA
GTATGATCAG GCTGTGGGTG GTGGTCACAT GGCTGGTTCT TTGGGCCGCA GCTGCGGTGC ACCCCGGGGA GCAGCCGCTG
TCGAGGATTG CCGTCGAGAG GATGGTCCTT GCCGTCAACG AGTCGGCACA TGTCAGGGCG TCCCCTTTGG TTCTTGGGCT
GAAGGTCAGC TCCATTTCTC ACCTACTGCC ATGAGAATCT GCAGTTCTTC AGAGTTCAGA CACAGTAATC GTTTGCTGAG
TTGGTTGTGA ATTTCTGATG CTACAGGGTG AGACCAATGA ATGGGTAGAG GTAGAGTTCT TCAATCCAAA CCCCTCCAat
actgactggg ttggagtgtt ttctcctgct gattttaggt aacatgaact gaaattttca ggtgaagctg aaatttagca
caagttttga taattctttt ttgtttcttg tgttggatat tgtcagttct gcaatctgtg aggcttatgg tgttccacag
tattacccaa tgctctgcac agcacctatc aaggttgcca agttttttcc tgttccagtt aattaagatt cagatataca
ttttcttaaa aaaaaatcag atatagctcc ttgccatgat tttgactttt tttttggtct tcaattaatc gcagtaccaa
tatgcaaact tcaataataa tggttatagt aagtctggga agggcaaact gaagcttcag ttgatcaacc agagggagga
tttctcattt gctctttttt ctggtggCCT CGAGAATGTA AGACCAAAAG AAAAAAAAAG ATTCTTCTGA ACTTCTCTTT
CTATATTTAT TTTTTGGAAG GAAAAAACAT ACATTTTTCT TTTCATATTC TCATGACTGA AGATAATTCA CTCCTTTAAT
AGCCAAAGCT GGTTGCTGTC TCAAACAAGA TCGCATTTGC GAATCCGAAG GCGCCTGTTT ACCCACGTTT AGCTCAAGGG
AAGTCTTGGA ATGAAGTAAG TTTCCCAACC AATCTGGAAT TAACATGAAT GTTCAAGTTA TTCAGCTAGT CTTTTCTAAG
TGGACCAATG GAGCAAGAGT GTAGCTTTCA TCATACAAGA TTGATGTCTA AAAAAAATTC AAAAAAAAGG TGACTGAATT
AGTACTGTGG TAGATGACAG TAACTTGGAC AAGTGGGTAC GATTTTAAAG AAGCAGTTCC TTTCGTCGAA TGGGGCGCGA
AAGGGGGACA ACGGGTCCTT TCTCCAGCTG GAACATTAAC ATTTGACAGA AATAGCATGT GTGGTATGTC ACTATATCCT
GTTGAACATC AGATAGCTAA AGTTCGGTCT TCTCTCAAAA AGTAAtactc cctccgtttc agattataag tcattttgac
tttggtcaaa gtcaaactgc tttaagtttg accaagtttg taggaaaaaa ataataacat tttcaaccca ggataaattt
attaagagaa tgtatttaat tattgattga aactaatttg gtattataaa tattactata tttatctata aacatagtta
aatttgaagg agtttgactt tgaccaaagt taaaacgact tataatctga aatggaggga gtaGTTTAGA ATTTATAATG
CCATCATAAC TTAATATAGT AGTGTGGTAC GGGTAACACT GCATTTCTGT TCTCTGAATG TCATATCAAC CACTTCATTT
CAACGATTCA ATCTACTAAT GTAGGTGCAC CGGCACGAAC TGTCGGTTGG CGCCATCCTG GTTACATTCA TACAAGCTAC
TTGAAAGAAC TGTGGCCAGA TTCACTGTAT GTGATCTATC TTGCCGCCTC CTGAATTTCG ACACATCCAG AAATTAAGCA
GTATGGTTTA CTTTGCAACA TTTCAGGTAT ACTTACAGAC TTGGCCATAG GTTACCAAAT GGTACTCACA TCTGGAGTAA
GTCATACAGC TTCAAAGCAT CACCTTATCC TGGGCAAGAT TCCGTTCAGA GAGTAGTCAT ATTTGGAGAC ATGGGAAAGG
TAGATATTGT ACTATTTGTA TCTGGTGTTC ATTAACTGTT GAGCATGGTG TTCTGAAAAA AAACACAGTG ATAGTGATAT
TCTTTCCTGA TATAtttcct caggcagagg cagacggttc aaatgagttc aatgacttcc agccaggatc attgaacact
acttaccaga tcatcagaga cctgaaaaac attgacatgg ttgtccatat tggggatatt tgctatgcaa atggttactt
gtcgcagtgg gatcagttca ctgcgcagat cgagccaatt gcttcgactg ttccatacat gattggcatg tcagtatctc
atttcattgc ttgtgttctt ccaattgttc ttgtctaaca attgtaaatg ggcacttctg caggggtaat catgagaggg
attggcctgg aactggttca ttctatggaa accttgactc tggaggagaa tgtggtgttc ctgctcaaac tgtattctac
actcctgctg agaaccgtgc aaaattatgg taATTCTATG GCTCAGTGTG GCTACATCAG TTGTTACAAC TTTTGCCATT
TCTGAATTTT ACTAAAACAA CTTttatcct tcttcaggta tgcgacagac tatggcatgt tcaggttctg cattgctaat
acagaagagg actggaggcc agggactgag cagtacaagt tcatcgagca atgcctatcg tccgtcgaca ggcagaagca
gccatggctc atattccttg cgcaccgagt tctcgggtac tcatcctgca ccttttatga agaagagggt acatttgagg
aaccgatggg ccgagaatca ctacaggagc tttggcagaa gtacaaggtt gaCCTCGCCT TCTATGGCCA TGTCCACAAC
TATGAAAGAA CATGCCCAGT CTATCAGGTG TGTATCTAAT TACCATTTGC TTCAACTCAA ATTGCAGTTT TGCAGATTGA
AAAGTTTTTA TTCACTGTAT GCACAAGTTT GTAGGACAGT ACCTTATAAT ATATTTTGTT ACAAAAAACC TAACTGATAG
GTAGTATTGT CGGTAATGCT ACAGTCAACA TATAGTTAGC ACACTCGACA ATTGCATGTT ACAAAATTAC TGTACTGACT
ACAATCTTTG ATTGATTTCA GAATAAATGT GTTGTTAGTG GTTCAGATCA TTACAGTGGT CCTTTCACCG CGACAACACA
TGTGGTCGTT GGAGGTGCTG GTGCTGGTAC CTCCGACTCA GAATTCACCA CTTCAAATAT CAAATGGAGT TACTACAGGG
ACTTTGACTA CGGTTTTGTC AAGCTCACAG CTTTAAATCA TTCATCCTTA TTGTTTGAGT ACAAGAAAAG CAGTGACGGC
AATGTGTATG ATCATTTCAC AATCTCACGT GATTACCGAG ACATCCTGGC TTGTTCAATT GACAACTGTC CTCGGACCAC
ACTGGCTACC TAAAGCATGA ACAGTTCTAG ACAGGTTTAC AGGTAGATTG ATTGACAGGG CCTCAAAGAG CAATCTAGTT
CCTGTACAAA GTCTTTTGGG ACTATTCCAA TAAATCATAA TAAACACGGA ATTTTCTTGA CTGCGT