Os12t0576750-01

Locus

Os12g0576750

Description

Nucleotide pyrophosphatase, Hydrolysis of UDP, ADP and adenosine 5'-phosphosulfate

RAP-DB Gene Symbol Synonym(s)

PAP1B, OsPAP1b, NPP2, OsNPP2

RAP-DB Gene Name Synonym(s)

PURPLE ACID PHOSPHATASE 1B, purple acid phosphatase 1b, Nucleotide pyrophosphatase/phosphodiesterase 2

CGSNL Gene Symbol

PAP1B

CGSNL Gene Name

PURPLE ACID PHOSPHATASE 1B

Oryzabase Gene Symbol Synonym(s)

OsPAP1b, NPP2, OsNPP2

Oryzabase Gene Name Synonym(s)

purple acid phosphatase 1b, Nucleotide pyrophosphatase/phosphodiesterase 2

Transcript Evidence

AB196673

Protein Evidence

I4DHV7

Literature

PMID: 24092883

Note

Manual Curation

November 21, 2014

Gene Ontology (GO)

Molecular Function: acid phosphatase activity (GO:0003993)

Molecular Function: hydrolase activity (GO:0016787)

Molecular Function: metal ion binding (GO:0046872)

Functional domain (InterPro)

Purple acid phosphatase-like, N-terminal (IPR008963)

Purple acid phosphatase, N-terminal (IPR015914)

Metallo-dependent phosphatase-like (IPR029052)

Calcineurin-like phosphoesterase domain, apaH type (IPR004843)

Iron/zinc purple acid phosphatase-like C-terminal domain (IPR025733)

Expression Databases

TENOR (Os12t0576750-00)

Others

Oryzabase (11373)

Transcript

2031 bp

>Os12t0576750-01 Nucleotide pyrophosphatase, Hydrolysis of UDP, ADP and adenosine 5'-phosphosulfate
GCAGTCTTCTGTGGTTTTGCAGGGTGAAGCAGATGAGCTGAAGCAAATGAGGTTCTTGAT
CATGGCAGCCATCAGGTGGGTGGTTCTTGCATACATTGTCGTCATCGGATGCGCCACTAT
TGCGCGTGGCGATGAGCAGCCACTGTCGAGGATTGCGATCGAGAGGGCGACGGTTGCTGC
TGTTGATTCAGCCAGCGTGAAGGCTCAACCGACAGTTCTTGGCCTGAAGGGTCAAAGTAG
TGATTGGGTGGTGGTTGAATTCTCCCATCCGAAACCCTCCAACGACGATTGGATTGGTGT
CTTTTCTCCTTCTGGATTCAGCTCTGAAATATGCCAACCTGAATACTATGGAGACCTCCC
ACCCTATCTGTGTACATCACCTATCAAGTTCCAGTATGCAAATTTCAACAATGCTGACTA
CAACAGAAGTGGCAAGGGATTGCTGAGGCTGCAATTGATCAACCAGAGAGAAGACTTCTC
ATTCGCGCTCTTTTCGGGAGGCCTTTCTGCTCCAAAGCTGATTGCTATCTCAAACAAAGT
ATCGTTCCAGAATCCGAAGGCACCCGTCTATCCTCGGTTAGCACAGGGGAAATCTTGGAA
TGAAATGACAGTCACATGGACAAGTGGATACAGCATTAAGGAAGCTATACCATTTGTCGA
ATGGGGTCATAAAGGCGGAAACCAGATGCTTTCTCCTGCTGGAACGTTGACATTCAGCAG
AAATAGCATGTGTGGTTCACCTGCACGGACAGTCGGATGGCGTGATCCTGGATACATTCA
TACAAGTTTCTTGAAGGAATTGTGGCCTGATTCCTTATACACTTACAGGCTTGGTCACAG
ACTACTAGATGGTACTCACATTTGGAGCAAGTCTTACAGCTTCCGAGCATCTCCTTATCC
CGGACAAGATTCTGTGCAACGTGTCGTGATCTTCGGAGACATGGGAAAGGCAGAAATAGA
TGGTTCTGATGAGTATGGAAACTATGAGCAAGCCTCCTTATACACTACCAACCAGCTAAT
CAAGGAATTGGATAGCATTGATATGGTTATCCACATTGGAGACCTTtcatatgccaatgg
ctatttgtcgcagtgggatcagttcacacagcagatagagccgatcgcttcaactgtgcc
ttacatgattggcagtggtaatcatgagagagattggcctggaagcgggtcattctatgg
acacaacgattctggtggcgaatgtggggtccctactcagaccatgttctatgtcccagc
tgagaacagggcaaaattatggtactcgacagactatggcatgttcagattttgcatagc
tgatactgaacaggactggagaccaggaactgagcagtataagttcatcgagcaatgcct
gtcgtcggtcgacaggtcgaagcaaccatggctcatcttccttgcacatcgggttcttgg
atactcatctgcgagttggtatgagatcatgatgggatcatatggtgaaccaatgggccg
agatggtctcgaggaactctggcagaagtacaaggttgatctcgcagttttcggtCATAT
ACACAGCTATGAGCGCACTTGCCCCATTTATCAGAACCGATGTGTCCAGGATGGCTCAAA
CCTTTACACCGGTCAATTCAATGCGACTACTCATGTAATTGTGGGAGGAGGCGGCGCGAT
GCTCTCTCCCTTCAGAGCCACTGTACCCTATTGGAGCTTCTTCAGGGACTACGACTTTGG
GTTCTCGAAGCTCACTGCACTCAACCACTCTACGCTTCTGTTCGAGTACAAGAAGAGCCG
GGATGGAAAGGTCTATGACCACTTCACCATCTCGCGTGATTACCGAGATATCATGGCATG
CTCAATTGATAACTGCCCAAGAACCACCTTGGCAGTATGAACAGCCTCCACTAGTTCATT
GTCATTATCTTTGTGAAGTGTTAGTATGTGCTGAAGCATATATGCTAAGCATTGTACTGT
TTGACACTGGATTATCTAGTGATATAGTGACAGTGGAGCTGGAATAAACCA

CDS

1854 bp

>Os12t0576750-01 Nucleotide pyrophosphatase, Hydrolysis of UDP, ADP and adenosine 5'-phosphosulfate
ATGAGGTTCTTGATCATGGCAGCCATCAGGTGGGTGGTTCTTGCATACATTGTCGTCATC
GGATGCGCCACTATTGCGCGTGGCGATGAGCAGCCACTGTCGAGGATTGCGATCGAGAGG
GCGACGGTTGCTGCTGTTGATTCAGCCAGCGTGAAGGCTCAACCGACAGTTCTTGGCCTG
AAGGGTCAAAGTAGTGATTGGGTGGTGGTTGAATTCTCCCATCCGAAACCCTCCAACGAC
GATTGGATTGGTGTCTTTTCTCCTTCTGGATTCAGCTCTGAAATATGCCAACCTGAATAC
TATGGAGACCTCCCACCCTATCTGTGTACATCACCTATCAAGTTCCAGTATGCAAATTTC
AACAATGCTGACTACAACAGAAGTGGCAAGGGATTGCTGAGGCTGCAATTGATCAACCAG
AGAGAAGACTTCTCATTCGCGCTCTTTTCGGGAGGCCTTTCTGCTCCAAAGCTGATTGCT
ATCTCAAACAAAGTATCGTTCCAGAATCCGAAGGCACCCGTCTATCCTCGGTTAGCACAG
GGGAAATCTTGGAATGAAATGACAGTCACATGGACAAGTGGATACAGCATTAAGGAAGCT
ATACCATTTGTCGAATGGGGTCATAAAGGCGGAAACCAGATGCTTTCTCCTGCTGGAACG
TTGACATTCAGCAGAAATAGCATGTGTGGTTCACCTGCACGGACAGTCGGATGGCGTGAT
CCTGGATACATTCATACAAGTTTCTTGAAGGAATTGTGGCCTGATTCCTTATACACTTAC
AGGCTTGGTCACAGACTACTAGATGGTACTCACATTTGGAGCAAGTCTTACAGCTTCCGA
GCATCTCCTTATCCCGGACAAGATTCTGTGCAACGTGTCGTGATCTTCGGAGACATGGGA
AAGGCAGAAATAGATGGTTCTGATGAGTATGGAAACTATGAGCAAGCCTCCTTATACACT
ACCAACCAGCTAATCAAGGAATTGGATAGCATTGATATGGTTATCCACATTGGAGACCTT
tcatatgccaatggctatttgtcgcagtgggatcagttcacacagcagatagagccgatc
gcttcaactgtgccttacatgattggcagtggtaatcatgagagagattggcctggaagc
gggtcattctatggacacaacgattctggtggcgaatgtggggtccctactcagaccatg
ttctatgtcccagctgagaacagggcaaaattatggtactcgacagactatggcatgttc
agattttgcatagctgatactgaacaggactggagaccaggaactgagcagtataagttc
atcgagcaatgcctgtcgtcggtcgacaggtcgaagcaaccatggctcatcttccttgca
catcgggttcttggatactcatctgcgagttggtatgagatcatgatgggatcatatggt
gaaccaatgggccgagatggtctcgaggaactctggcagaagtacaaggttgatctcgca
gttttcggtCATATACACAGCTATGAGCGCACTTGCCCCATTTATCAGAACCGATGTGTC
CAGGATGGCTCAAACCTTTACACCGGTCAATTCAATGCGACTACTCATGTAATTGTGGGA
GGAGGCGGCGCGATGCTCTCTCCCTTCAGAGCCACTGTACCCTATTGGAGCTTCTTCAGG
GACTACGACTTTGGGTTCTCGAAGCTCACTGCACTCAACCACTCTACGCTTCTGTTCGAG
TACAAGAAGAGCCGGGATGGAAAGGTCTATGACCACTTCACCATCTCGCGTGATTACCGA
GATATCATGGCATGCTCAATTGATAACTGCCCAAGAACCACCTTGGCAGTATGA

Protein

618 aa

>Os12t0576750-01 Nucleotide pyrophosphatase, Hydrolysis of UDP, ADP and adenosine 5'-phosphosulfate
MRFLIMAAIRWVVLAYIVVIGCATIARGDEQPLSRIAIERATVAAVDSASVKAQPTVLGL
KGQSSDWVVVEFSHPKPSNDDWIGVFSPSGFSSEICQPEYYGDLPPYLCTSPIKFQYANF
NNADYNRSGKGLLRLQLINQREDFSFALFSGGLSAPKLIAISNKVSFQNPKAPVYPRLAQ
GKSWNEMTVTWTSGYSIKEAIPFVEWGHKGGNQMLSPAGTLTFSRNSMCGSPARTVGWRD
PGYIHTSFLKELWPDSLYTYRLGHRLLDGTHIWSKSYSFRASPYPGQDSVQRVVIFGDMG
KAEIDGSDEYGNYEQASLYTTNQLIKELDSIDMVIHIGDLSYANGYLSQWDQFTQQIEPI
ASTVPYMIGSGNHERDWPGSGSFYGHNDSGGECGVPTQTMFYVPAENRAKLWYSTDYGMF
RFCIADTEQDWRPGTEQYKFIEQCLSSVDRSKQPWLIFLAHRVLGYSSASWYEIMMGSYG
EPMGRDGLEELWQKYKVDLAVFGHIHSYERTCPIYQNRCVQDGSNLYTGQFNATTHVIVG
GGGAMLSPFRATVPYWSFFRDYDFGFSKLTALNHSTLLFEYKKSRDGKVYDHFTISRDYR
DIMACSIDNCPRTTLAV*

5'UTR

chr12:23822925..23822961 (- strand) : 37 bp

chr12:23822342..23822350 (- strand) : 9 bp

CDS

chr12:23822159..23822341 (- strand) : 183 bp

chr12:23821964..23822055 (- strand) : 92 bp

chr12:23821796..23821862 (- strand) : 67 bp

chr12:23821584..23821706 (- strand) : 123 bp

chr12:23821407..23821499 (- strand) : 93 bp

chr12:23821158..23821287 (- strand) : 130 bp

chr12:23820980..23821061 (- strand) : 82 bp

chr12:23820684..23820816 (- strand) : 133 bp

chr12:23820411..23820616 (- strand) : 206 bp

chr12:23820186..23820311 (- strand) : 126 bp

chr12:23819789..23820101 (- strand) : 313 bp

chr12:23819296..23819601 (- strand) : 306 bp

3'UTR

chr12:23819165..23819295 (- strand) : 131 bp

FASTA

>Os12t0576750-01 class=Sequence position=chr12:23819165..23822961 (- strand)
GCAGTCTTCT GTGGTTTTGC AGGGTGAAGC AGATGAGGTT TCTCTATTTT TGTTCCCTCA TCTATCAGTT CCATATCTAA
ACCAGAAATT CTTTTTTTTT GTTTTTCCAC ATTGTTTTTC TTCTTCTTTG CTTTCTCTAT TTTGTTTCCT TTCCTCGGTT
CCTTCTAATC ATTCCTCATT GCTTTTCTTC CTCTTCTTTT CTTCCTCTAT CTTCTCAGTT CCTTCCAAGT CAGAAATTCC
TTATTTTCTT CTCATTGTTT TTCTTCCTTC TTTTCCTTCT ATATTTTTTG TTTCCGCAGT TCCTTCTAAA CCAGAGATTA
TCTGCTCCAA AGTTAAAAAC AATGTTCATT AGTTCCTCGG TTTTGTTTTG TAAAACTACA GATTCAAAGA ACGTGCACAA
TGTGTGATGA AATGATCGTT ATCTTAGCCC ATTTTGGGCC TCCACTTGAC CACTTGTTAT TTTTTCCTTT CTTGCTCAAA
TGCCGACCTG TGTTGGCAGC TAGCTTCCCC TGATCTTCCC CCTTGGCCAT TTCCTAACCT CTCAACACTC TGTCATTTAG
CCATAAATTC AATCCACTGT CCAGCTAAAT TCCTACAGAA TCTTGCTGCA GCTGAAGCAA ATGAGGTTCT TGATCATGGC
AGCCATCAGG TGGGTGGTTC TTGCATACAT TGTCGTCATC GGATGCGCCA CTATTGCGCG TGGCGATGAG CAGCCACTGT
CGAGGATTGC GATCGAGAGG GCGACGGTTG CTGCTGTTGA TTCAGCCAGC GTGAAGGCTC AACCGACAGT TCTTGGCCTG
AAGGTTTGCT GCTCATTTGC TTCATAGAAA CACTGATTTC TTAATTGCAT AATTACAATG AAATCTCATG CACTTTTACC
CTTTTTTGCG GCTATGTATG TTTCAGGGTC AAAGTAGTGA TTGGGTGGTG GTTGAATTCT CCCATCCGAA ACCCTCCAAC
GACGATTGGA TTGGTGTCTT TTCTCCTTCT GGATTCAGGT CAGCTGCAAG CATGTGTTGA TTTGCATATA TCTTGTCTAA
ATTGTGTACT AGAACTATAA ATGGAACGAT GGCATCATTC AATGTCTGAA CATTTTTAGC TCTGAAATAT GCCAACCTGA
ATACTATGGA GACCTCCCAC CCTATCTGTG TACATCACCT ATCAAGGTTG GTGCCCTCCC GTCCTTTCAT ATTTTTCATA
TTTATGCTGC TATTCATGAT GCATCATGGA TTGAGTTTTG GAAGGTTCTC TGCAGTTCCA GTATGCAAAT TTCAACAATG
CTGACTACAA CAGAAGTGGC AAGGGATTGC TGAGGCTGCA ATTGATCAAC CAGAGAGAAG ACTTCTCATT CGCGCTCTTT
TCGGGAGGCC TTTCTGCTGT AGGATTTCAG CATATATCAT CTCACATTTT GAATAGTTTT TGGAATTGAC ATTTTTCCTG
ACAATTTTTC ATGCTGTTGC AGCCAAAGCT GATTGCTATC TCAAACAAAG TATCGTTCCA GAATCCGAAG GCACCCGTCT
ATCCTCGGTT AGCACAGGGG AAATCTTGGA ATGAAGTGAG AATAATCCTC TTGCTTATTG TAACAATGCA AGTGGACATG
TTGATTACTT GATAGCTTAA TTATCTTCAA ATATCTTTCT CACTTTAGTG ACTGAACTGT TAATACCACA CTAGATGACA
GTCACATGGA CAAGTGGATA CAGCATTAAG GAAGCTATAC CATTTGTCGA ATGGGGTCAT AAAGGCGGAA ACCAGATGCT
TTCTCCTGCT GGAACGTTGA CATTCAGCAG AAATAGCATG TGTGGTGTGT TTTATCAACA ATCTTTTCTC TTGGCAAATG
ATCATTTTGC TTTGATGGAA ATGGCATTTT TCATATTTTT TGTACAACCT CTTTCTGCAG GTTCACCTGC ACGGACAGTC
GGATGGCGTG ATCCTGGATA CATTCATACA AGTTTCTTGA AGGAATTGTG GCCTGATTCC TTGTATGTGA TCTGCATTAC
TTCCTTCAAC CAGCATTCTC TTTTCTTTTT ATTCCTTTAT TAGTTATTTC TATAGATAAT TTTAGTTAAC TGGATAATAG
CCTTCTGTAA ACTAGGTTAC AAAGATGACA TGATATATTG TTGTTTCTGG TTGGCCACTA TGCAGATACA CTTACAGGCT
TGGTCACAGA CTACTAGATG GTACTCACAT TTGGAGCAAG TCTTACAGCT TCCGAGCATC TCCTTATCCC GGACAAGATT
CTGTGCAACG TGTCGTGATC TTCGGAGACA TGGGAAAGGT GAGCAGTTTG TGTATTGTTG TATTTCACTT CGATCCAGTC
TTTAACTCAC ATTTTACTTG TTTAGGCAGA AATAGATGGT TCTGATGAGT ATGGAAACTA TGAGCAAGCC TCCTTATACA
CTACCAACCA GCTAATCAAG GAATTGGATA GCATTGATAT GGTTATCCAC ATTGGAGACC TTtcatatgc caatggctat
ttgtcgcagt gggatcagtt cacacagcag atagagccga tcgcttcaac tgtgccttac atgattggca ggtcaattta
gtcaatttct cacaatttaa aagtactgac taatagtact tgtggtaagt ggtaacattg attcaatatt gatccttgtt
tgcatttcag tggtaatcat gagagagatt ggcctggaag cgggtcattc tatggacaca acgattctgg tggcgaatgt
ggggtcccta ctcagaccat gttctatgtc ccagctgaga acagggcaaa attatggtaA TTTCAGCATA TTAAAGCCAT
ATAATTAGTT GAACTCATGT GATTACTTAT TGATGAAAAA AATTGTTATc ttatctccag gtactcgaca gactatggca
tgttcagatt ttgcatagct gatactgaac aggactggag accaggaact gagcagtata agttcatcga gcaatgcctg
tcgtcggtcg acaggtcgaa gcaaccatgg ctcatcttcc ttgcacatcg ggttcttgga tactcatctg cgagttggta
tgagatcatg atgggatcat atggtgaacc aatgggccga gatggtctcg aggaactctg gcagaagtac aaggttgatc
tcgcagtttt cggtCATATA CACAGCTATG AGCGCACTTG CCCCATTTAT CAGGTAAACC TACAACCTAA ATTCTCATCA
AGAAATTATG TAACAGAAAC TCAGAAATCA AATTCATACA CCATGTCAGC TTTGTTTTCA ACTACTTTGC AGGACTTGCT
ACAGTAGATA TGTACTATTC CAGTAGCCTT GATTTACAAT TTATCAAATG TGTGACAAAT TTCATTTTAC TTGGTTGCAG
AACCGATGTG TCCAGGATGG CTCAAACCTT TACACCGGTC AATTCAATGC GACTACTCAT GTAATTGTGG GAGGAGGCGG
CGCGATGCTC TCTCCCTTCA GAGCCACTGT ACCCTATTGG AGCTTCTTCA GGGACTACGA CTTTGGGTTC TCGAAGCTCA
CTGCACTCAA CCACTCTACG CTTCTGTTCG AGTACAAGAA GAGCCGGGAT GGAAAGGTCT ATGACCACTT CACCATCTCG
CGTGATTACC GAGATATCAT GGCATGCTCA ATTGATAACT GCCCAAGAAC CACCTTGGCA GTATGAACAG CCTCCACTAG
TTCATTGTCA TTATCTTTGT GAAGTGTTAG TATGTGCTGA AGCATATATG CTAAGCATTG TACTGTTTGA CACTGGATTA
TCTAGTGATA TAGTGACAGT GGAGCTGGAA TAAACCA

Locus: Os12g0576750

Loading...

Locus: Os12g0576750

Loading...