Os12t0582800-01

Locus

Os12g0582800

Description

Protein of unknown function DUF221 domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

OSCA2.4

CGSNL Gene Name

HYPEROSMOLALITY-GATED CALCIUM-PERMEABLE CHANNEL 2.4

Oryzabase Gene Symbol Synonym(s)

OsOSCA2.4, OsIOSCA2.4, OsDDP9, DDP9, OsDDP9.1

Oryzabase Gene Name Synonym(s)

Hyperosmolality-gated calcium-permeable channel 2.4, DUF221 Domain containing Protein 9

Transcript Evidence

AK111649 (DDBJ, Best hit)

Protein Evidence

A2ZM40 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

Domain of unknown function DUF221 (IPR003864)

Full-length cDNA

J013134M11 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0582800-01)

RiceXPro (AK111649)

Others

Oryzabase (19657)

KEGG (Os12t0582800-01)

Transcript

2603 bp

>Os12t0582800-01 Protein of unknown function DUF221 domain containing protein.
GTAAAAGCATAGTGAGCTCTCCCGTGCCACCGACAGGTGGGCCCCACCCGCGCGGCGGAA
GGTTCTAGGCTCTCCGGCGAAGGTTCTGGAAGGTTCGGGAGGAGGGGGGAGATGATTCTG
TCGGCGCTCGCGACTTCGGTGGGGATCAACCTGGGGCTGACGGTGCTCCTCGCGGCGGCG
TACACGCTGCTCCGGCGGCGCCCGCCGTACGTCGCCGTGTACTCGCCGCGGCGGCCGTAC
GCGCCGCCGGAGCCGTGGCTGCCCGCGGCGTGGCGCCGCACCGAGGCCGACGTCCACGCC
GCCGCCGGGCTCGACGGCGTCGTCTTCCTCCGCATCTTCGTCTTCAGCATTAGGGTGTTC
GCGGCGGCGGCGGTGGTGGGGGTGGGAGTGCTGATGCCGGTGAACTTCATGGGGGACCAG
CTGCGGCAGATTGACTTCTCCGATCTGCCCAACAAGTCCGTCGATCTCTTCAGCGTCTCC
AACGTGCAGGATGGCTCCAACAAATTGTGGCTCCACTTTTCGGCTGTGTACATCATAACT
GGAATTACATGCTACCTCCTTTATTATGAATACAAATATATTTCTGGCAAGAGGCTCGAA
TATTTTATGACATCAAAACCACTACCTCAGCATTTCACAGTTCTAGTTCGAGCTATACCT
GTAACCAATGGTGTGTCTGTGAGTGATGCTGTTGATAAGTTCTTCAAAGAGTACCATTCA
TCTACCTACTTGTCACACACTGTTGTTCATCAAACTGGCAAACTCCGCCGCCTTCTTAAT
GACGCTGAGAATATTTGCACAAAGCTTGCCAACTTGAAGTCTGTACGGCGTACTTCTGGA
GATCCTCCAGGAAAATTTCTTGGAATATTTGGCAGAAATGATCTTGTTGGGAAATATCAG
AAAAGGCTGGAGGACCTAGAAGAAAATGTTAGAATGGAACAATCAGACACTACTAGGAGC
AGACAGGAAGTTCCCGCTGCTTTTGTGTCATTCAGATCTCGATATGGTGCTGCAAATGCT
ATTTACATAAGACAATCAGACAAGCCTACTGAGTGGCAGACTGAGCATGCTCCTGATCCC
CATGACGTTTATTGGCCTTTCTTTTCAACATCATTCATGGACAGATGGATATCCAAGTTT
GTAGTCTCTGTAGCTTCTATTCTCCTGATACTCGTCTTTCTCCTAGTTTCGGCATTTGTT
CAAGGACTCACCTATATGGAACAGCTAGAGACATGGTTGCCTTTCCTGAGAAATATACTG
GAAATAGCTGTTGTCAGTCAGTTGGTTACAGGATATCTTCCCAGTGTCATTCTTCACTTT
CTTTCCTCTTATGTGCCCTCTATAATGAAGCTGTTTTCAACAATGCAAGGATTCATCTCT
GTTAGTGGGATTGAGAGAAGTGCTTGCAACAAAATGCTTCGGTTTACAATATGGAGTGTG
TTCTTTGCAAATGTTCTTACTGGCTCAGTACTTGGTCAACTCGAGATATTCCTTGATCCG
AAGGAAATCCCTAAAAGGCTTGCAGTTGTTGTACCAGCACAGGCCTCTTTCTTTATTACA
TATGTTGTGACATCTTGGACAAGTATAGCATCAGAACTTACTCAAACTGCTGCCCTTTTA
TTCCATTTGTGGGGTAGCTGTGCAAAATGCTGCAAGAGGGATGAGTCCAAACCTCCATCA
ATGCATTACCATAGTGAAATTCCTCGGGTTCTCCTGTTTGGACTTCTTGGGCTCACATAC
TTCATTGTATCCCCACTTATCCTCCCATTTGTACTGGTTTACTTCTGCCTTGGCTACTTC
ATATATCGTAATCAGCTTTTTAATGTATATTCACCCAAGTATGACACTGGTGGAAGATTC
TGGCCCATTGTGCACGGGGGAACAATATTTTCTCTGGTGCTGATGCATGTTATTGCAATT
GGAGTATTTGGATTGAAGAAACTTCCCCTTGCATCAAGTTTGCTGGTACCTCTTCCAGTG
CTGACCCTTCTGTTCAATGAATACTGCCGGAACAGATTTTTACCGATCTTCGAAGCATAT
TCTACTGAGTCATTGATAAAGAAAGACAGAGAAGAAGAGAGCAAACCAGAAATGGCAGAA
TTCTTCAGCAATCTTGTAAATGCGTACTGTGACCCGGCGATGAAACCTATCCAACACTCC
TCGAATTCAGATGAACGCACTACACCTCTATTGTCTTAGATCCAGATAAGTAATAGCTTG
CAGCCTTACTGTCATGGCGTGAATTTTGGTTTGACACCGATAATCAGGCATACAACAATA
CACCTGTGCTTCTTCTTGTGATGTTACTGTTGTAAAGCATTACTACATACTTGACTGTGG
AGTtgttgtgcatatttgatttgtacatcttaatttgtgcttactgcgtagagatgaata
atgcattGCTCCTTAATGAAGTGCTGTCAATGCAAACCTGTGTGGGTTGTACTTCTAGAT
ATGTCAAATCACCTTTATTTGTTCCCTTCAAATTTTGTGTATATGGATGTTCTTTTGCTT
CAACCTATTCAGTAATGAGATTATTTGGCAGTTGGAATGATGTGATATTAGTACTGATAC
ATTATTATCAGTTTATTTGAGTT

CDS

2088 bp

>Os12t0582800-01 Protein of unknown function DUF221 domain containing protein.
ATGATTCTGTCGGCGCTCGCGACTTCGGTGGGGATCAACCTGGGGCTGACGGTGCTCCTC
GCGGCGGCGTACACGCTGCTCCGGCGGCGCCCGCCGTACGTCGCCGTGTACTCGCCGCGG
CGGCCGTACGCGCCGCCGGAGCCGTGGCTGCCCGCGGCGTGGCGCCGCACCGAGGCCGAC
GTCCACGCCGCCGCCGGGCTCGACGGCGTCGTCTTCCTCCGCATCTTCGTCTTCAGCATT
AGGGTGTTCGCGGCGGCGGCGGTGGTGGGGGTGGGAGTGCTGATGCCGGTGAACTTCATG
GGGGACCAGCTGCGGCAGATTGACTTCTCCGATCTGCCCAACAAGTCCGTCGATCTCTTC
AGCGTCTCCAACGTGCAGGATGGCTCCAACAAATTGTGGCTCCACTTTTCGGCTGTGTAC
ATCATAACTGGAATTACATGCTACCTCCTTTATTATGAATACAAATATATTTCTGGCAAG
AGGCTCGAATATTTTATGACATCAAAACCACTACCTCAGCATTTCACAGTTCTAGTTCGA
GCTATACCTGTAACCAATGGTGTGTCTGTGAGTGATGCTGTTGATAAGTTCTTCAAAGAG
TACCATTCATCTACCTACTTGTCACACACTGTTGTTCATCAAACTGGCAAACTCCGCCGC
CTTCTTAATGACGCTGAGAATATTTGCACAAAGCTTGCCAACTTGAAGTCTGTACGGCGT
ACTTCTGGAGATCCTCCAGGAAAATTTCTTGGAATATTTGGCAGAAATGATCTTGTTGGG
AAATATCAGAAAAGGCTGGAGGACCTAGAAGAAAATGTTAGAATGGAACAATCAGACACT
ACTAGGAGCAGACAGGAAGTTCCCGCTGCTTTTGTGTCATTCAGATCTCGATATGGTGCT
GCAAATGCTATTTACATAAGACAATCAGACAAGCCTACTGAGTGGCAGACTGAGCATGCT
CCTGATCCCCATGACGTTTATTGGCCTTTCTTTTCAACATCATTCATGGACAGATGGATA
TCCAAGTTTGTAGTCTCTGTAGCTTCTATTCTCCTGATACTCGTCTTTCTCCTAGTTTCG
GCATTTGTTCAAGGACTCACCTATATGGAACAGCTAGAGACATGGTTGCCTTTCCTGAGA
AATATACTGGAAATAGCTGTTGTCAGTCAGTTGGTTACAGGATATCTTCCCAGTGTCATT
CTTCACTTTCTTTCCTCTTATGTGCCCTCTATAATGAAGCTGTTTTCAACAATGCAAGGA
TTCATCTCTGTTAGTGGGATTGAGAGAAGTGCTTGCAACAAAATGCTTCGGTTTACAATA
TGGAGTGTGTTCTTTGCAAATGTTCTTACTGGCTCAGTACTTGGTCAACTCGAGATATTC
CTTGATCCGAAGGAAATCCCTAAAAGGCTTGCAGTTGTTGTACCAGCACAGGCCTCTTTC
TTTATTACATATGTTGTGACATCTTGGACAAGTATAGCATCAGAACTTACTCAAACTGCT
GCCCTTTTATTCCATTTGTGGGGTAGCTGTGCAAAATGCTGCAAGAGGGATGAGTCCAAA
CCTCCATCAATGCATTACCATAGTGAAATTCCTCGGGTTCTCCTGTTTGGACTTCTTGGG
CTCACATACTTCATTGTATCCCCACTTATCCTCCCATTTGTACTGGTTTACTTCTGCCTT
GGCTACTTCATATATCGTAATCAGCTTTTTAATGTATATTCACCCAAGTATGACACTGGT
GGAAGATTCTGGCCCATTGTGCACGGGGGAACAATATTTTCTCTGGTGCTGATGCATGTT
ATTGCAATTGGAGTATTTGGATTGAAGAAACTTCCCCTTGCATCAAGTTTGCTGGTACCT
CTTCCAGTGCTGACCCTTCTGTTCAATGAATACTGCCGGAACAGATTTTTACCGATCTTC
GAAGCATATTCTACTGAGTCATTGATAAAGAAAGACAGAGAAGAAGAGAGCAAACCAGAA
ATGGCAGAATTCTTCAGCAATCTTGTAAATGCGTACTGTGACCCGGCGATGAAACCTATC
CAACACTCCTCGAATTCAGATGAACGCACTACACCTCTATTGTCTTAG

Protein

696 aa

>Os12t0582800-01 Protein of unknown function DUF221 domain containing protein.
MILSALATSVGINLGLTVLLAAAYTLLRRRPPYVAVYSPRRPYAPPEPWLPAAWRRTEAD
VHAAAGLDGVVFLRIFVFSIRVFAAAAVVGVGVLMPVNFMGDQLRQIDFSDLPNKSVDLF
SVSNVQDGSNKLWLHFSAVYIITGITCYLLYYEYKYISGKRLEYFMTSKPLPQHFTVLVR
AIPVTNGVSVSDAVDKFFKEYHSSTYLSHTVVHQTGKLRRLLNDAENICTKLANLKSVRR
TSGDPPGKFLGIFGRNDLVGKYQKRLEDLEENVRMEQSDTTRSRQEVPAAFVSFRSRYGA
ANAIYIRQSDKPTEWQTEHAPDPHDVYWPFFSTSFMDRWISKFVVSVASILLILVFLLVS
AFVQGLTYMEQLETWLPFLRNILEIAVVSQLVTGYLPSVILHFLSSYVPSIMKLFSTMQG
FISVSGIERSACNKMLRFTIWSVFFANVLTGSVLGQLEIFLDPKEIPKRLAVVVPAQASF
FITYVVTSWTSIASELTQTAALLFHLWGSCAKCCKRDESKPPSMHYHSEIPRVLLFGLLG
LTYFIVSPLILPFVLVYFCLGYFIYRNQLFNVYSPKYDTGGRFWPIVHGGTIFSLVLMHV
IAIGVFGLKKLPLASSLLVPLPVLTLLFNEYCRNRFLPIFEAYSTESLIKKDREEESKPE
MAEFFSNLVNAYCDPAMKPIQHSSNSDERTTPLLS*

5'UTR

chr12:24191443..24191553 (+ strand) : 111 bp

CDS

chr12:24191554..24191789 (+ strand) : 236 bp

chr12:24191897..24192052 (+ strand) : 156 bp

chr12:24192761..24192824 (+ strand) : 64 bp

chr12:24193112..24193321 (+ strand) : 210 bp

chr12:24194052..24194240 (+ strand) : 189 bp

chr12:24194418..24194716 (+ strand) : 299 bp

chr12:24194949..24195225 (+ strand) : 277 bp

chr12:24195419..24195691 (+ strand) : 273 bp

chr12:24196690..24196923 (+ strand) : 234 bp

chr12:24197081..24197230 (+ strand) : 150 bp

3'UTR

chr12:24197231..24197634 (+ strand) : 404 bp

FASTA

>Os12t0582800-01 class=Sequence position=chr12:24191443..24197634 (+ strand)
GTAAAAGCAT AGTGAGCTCT CCCGTGCCAC CGACAGGTGG GCCCCACCCG CGCGGCGGAA GGTTCTAGGC TCTCCGGCGA
AGGTTCTGGA AGGTTCGGGA GGAGGGGGGA GATGATTCTG TCGGCGCTCG CGACTTCGGT GGGGATCAAC CTGGGGCTGA
CGGTGCTCCT CGCGGCGGCG TACACGCTGC TCCGGCGGCG CCCGCCGTAC GTCGCCGTGT ACTCGCCGCG GCGGCCGTAC
GCGCCGCCGG AGCCGTGGCT GCCCGCGGCG TGGCGCCGCA CCGAGGCCGA CGTCCACGCC GCCGCCGGGC TCGACGGCGT
CGTCTTCCTC CGCATCTTCG TCTTCAGGTC CCGCTTCCCC GCTCTCCTCT CCTCCAATCT CGGCATACAC GCTGCTCGCT
TTACTATGGG GGATGGAGAT TGACGAGGTG ATGGGGGATT TTGGTGTTGT GCAGCATTAG GGTGTTCGCG GCGGCGGCGG
TGGTGGGGGT GGGAGTGCTG ATGCCGGTGA ACTTCATGGG GGACCAGCTG CGGCAGATTG ACTTCTCCGA TCTGCCCAAC
AAGTCCGTCG ATCTCTTCAG CGTCTCCAAC GTGCAGGATG GCTCCAACAA GTGAGCTATT TCGAGCTTCC TGATGCCTAA
TTTTTGTTCG CGGATTTAGG GGGTTTTAGT GGGTTTTGTG TGATTGTTAG TGCTTCAAGG TGGATACAAT TGTTTAATAA
TAATAAATTA CGTGCCAGTT ATAGATTAAA TTCTCGTTTT CGTATTAGGA GGATGAATCT CTTGGATTGT TTTAATGAGG
TTGAGTATTT TGTTTATGCT AGTGGCTATT GAGATGTTCA GAGTATGCTT CACTGCACAG TTTTAGCTTA GGATTGCTCA
GTTTGGTGAG CACTTTGATG GTTTTCTTTT CCTGGCCACT AGTCTATTTA TAAAGCATGA TTTGTTTTTC TCATTGGTTC
CTTATTTTTC TGAAATTCTA ATTTGTATTT TCTTTGTTTT GAAGGGGCAA AGTGCTAACT GCATGAAAAA AAACACAGAG
ATTCACTAAT TCACCTATTT GATGCTGTCT CGAGAAAATG CGTTGAATCT CTCTCATAAA AGAAAAATAT TTCTTTTAGT
AGTATTTAGA ATTTGATGTC GGTCATTTAA AATCCAACGG TTTCAAACAT GGGCCTGCAT GCTTAGGCCT TCTCCATGGC
TCCAGGCTGA TGCGACCATT TTGCTAGAGT GTTAAGTTGA TTTCTGTCTG GAATTTATCT TCATTATTGG GCTAGCAATG
CATAGCATAC TCATTACCGG TGGTAATGTG GTGAACAGAT TGTGGCTCCA CTTTTCGGCT GTGTACATCA TAACTGGAAT
TACATGCTAC CTCCTTTATT ATGTAAGTAA TTGAGTATTT TGCTTCTTTT TGGCTACCTA CTCACTGTTT TCAAACTAAT
TCAACATTTT ACTTCCCTCT CTTATATTTG TGCTAGACCT AATAATTTGA TCTATTTTCT TGATTGGATA CTTCTTCAGT
CAAACTCATT TGATATTTCA GTTACCATAC CATGCATGCT TGTCAGatct ggcattcatt tatcaaattc ttctcgttga
agttctgctt tgctgctttc ctgttttcac atcttTATGT ACACAATGGT TTATGTTAGC TCTTTGCAGG AATACAAATA
TATTTCTGGC AAGAGGCTCG AATATTTTAT GACATCAAAA CCACTACCTC AGCATTTCAC AGTTCTAGTT CGAGCTATAC
CTGTAACCAA TGGTGTGTCT GTGAGTGATG CTGTTGATAA GTTCTTCAAA GAGTACCATT CATCTACCTA CTTGTCACAC
ACTGTTGTTC ATCAAACTGG CAAACTCCGC CGCCTTCTTG TAAGATTCGA TTGTTTTGCT ACTTTCTATT GCTTCAGTAT
GGTTAACATC CTATATTTTA TCCATGGTTC CAACAACACT TACTATATGG GGTGTCTATA GATTGACTTA TTGCATTGGG
TACATGTTGT TGTATTGAAA GTAGATAGTG ATAGGTTTGC AAGGCTTGCA TTTTGTTTCA GTTATAATCA ATATGTTTTG
ACAACTTATT AGTCCTTTAC TTAATTTCTT GTGACTAAAA CAACTCACCA TACTGGAAGT TGCTATTTTA CTTTCAACAT
GTCACTTCTA ACTCTATGTT ATTAGTCTGA TATATACATC TAGTGATTAT GTCGAAAAGT AGATTTTAGA TTAAACGTGG
AGTCACAGAA TTGCTCCTTT CCATTGTTTC ATAAATAAAA TACAGAAAGT ATCTAATATG TTTCTGCCTA GACATGTCAA
AAAATTCAAG GGGAGAATAT ATACATCAGT TGTGATCCTC ATTTGAAAGT TGTCCGTATC TTATTTCACC TTTCAACACG
CAGATTTATT CCCTTTTTTT TTGTCATGCG AACAATTTTG TTTATCCTAA ATGTATCTTA AGAAATGGTA CACCAGTAGA
TTTTCTTCAT CAGCTGGAAA ACTAAACAGT TCCATCTCTA CATTTAGATC AACTTTATAA TGTCTTTGTT CTATATTGCT
TAATGTAATC TCCAGTTCCA TTTTGATAGT TAACTCCATC TCTGTCCAGA ATGACGCTGA GAATATTTGC ACAAAGCTTG
CCAACTTGAA GTCTGTACGG CGTACTTCTG GAGATCCTCC AGGAAAATTT CTTGGAATAT TTGGCAGAAA TGATCTTGTT
GGGAAATATC AGAAAAGGCT GGAGGACCTA GAAGAAAATG TTAGAATGGA ACAATCAGAC ACTACTAGGA GCAGACAGGT
GCATATTTCT ACCAATTTTG GTCTTGCTCA AACCATGATG TTTCAATATC TCCCTATCTG TTTGTTATAC TGCATTGGAA
TTAGTATTTG GCTCTGGTGC TCATCTTTCA GAAAATTTAT TTATAAACAT TTCAATATTT TGTCATCTGT TCTGATTTTC
TTTACATCTC TTTAGGAAGT TCCCGCTGCT TTTGTGTCAT TCAGATCTCG ATATGGTGCT GCAAATGCTA TTTACATAAG
ACAATCAGAC AAGCCTACTG AGTGGCAGAC TGAGCATGCT CCTGATCCCC ATGACGTTTA TTGGCCTTTC TTTTCAACAT
CATTCATGGA CAGATGGATA TCCAAGTTTG TAGTCTCTGT AGCTTCTATT CTCCTGATAC TCGTCTTTCT CCTAGTTTCG
GCATTTGTTC AAGGACTCAC CTATATGGAA CAGCTAGAGA CATGGTTGCC TTTCCTGAGA AATATACTGG AAATGTTAGT
GTTTATCCAT CTATTTATTT TTCACTACTT TCTGTATTTT GTTATTTCAG AAAGGAATCA CCATTTCTTA TAAAGTTCCA
GTTTGCAGCA GTCATGCATT TTTTTGGATG CTTAATTTGG GATACTAATA TTTACAAATT TTACCATGTT GGTTTTAATT
TTTCTAATGC ATTGCACAAT ATGATGGGAT TCACTAACCA AGCTAAAATT TATTTGATTG TTGCAGAGCT GTTGTCAGTC
AGTTGGTTAC AGGATATCTT CCCAGTGTCA TTCTTCACTT TCTTTCCTCT TATGTGCCCT CTATAATGAA GCTGTTTTCA
ACAATGCAAG GATTCATCTC TGTTAGTGGG ATTGAGAGAA GTGCTTGCAA CAAAATGCTT CGGTTTACAA TATGGAGTGT
GTTCTTTGCA AATGTTCTTA CTGGCTCAGT ACTTGGTCAA CTCGAGATAT TCCTTGATCC GAAGGAAATC CCTAAAAGGC
TTGCAGTTGT TGTACCAGCA CAGGTACAGC TTGCATTTAT TGTTGCCTTT AAAACTGCTT AGTGAGTGAA AAAGCTCTTT
GTTTTGTAGA TATTACTGTG GGCATTTCAA TGTAAAATCT GCTTTCTTAA ACAACTGTCT CTTGTGTAGT ATTGTATTGA
TCTCTTCCTC AACCGTGCAT TGCTAAACTG TCCTTTGTTT ATGCTTTGCT CTACAGGCCT CTTTCTTTAT TACATATGTT
GTGACATCTT GGACAAGTAT AGCATCAGAA CTTACTCAAA CTGCTGCCCT TTTATTCCAT TTGTGGGGTA GCTGTGCAAA
ATGCTGCAAG AGGGATGAGT CCAAACCTCC ATCAATGCAT TACCATAGTG AAATTCCTCG GGTTCTCCTG TTTGGACTTC
TTGGGCTCAC ATACTTCATT GTATCCCCAC TTATCCTCCC ATTTGTACTG GTTTACTTCT GCCTTGGCTA CTTCATATAT
CGTAATCAGG TGAGAGTGTT GCAGTTCATT TATCAGTACT TTATAATTTT CTGTTCTTCT ACTCATGGAG TCTTTATGCT
GTAATATACC TGGTTGGAAT TTGGAAGGAC ATATTAGTAC CTAAACCTGT TCGAAATTTG GATAGGGACT GACCAATTTG
TTTGACACTT GCATAGTAAT TTACTGAACT TGGTTTTGCA GACTGCCAGA CTTGGTACTT AAAATTCACT TACACCACAA
GGTGTAGATG GAATCAGGAT AACGTGGGTC CAACTATAAA TAACTTTTTC TTAGAATGTT TAGCACATAA TCGTAGTGTT
GTTTCCTGAA AGATGATCTA GATAATCTAG TGATGTAATT TGTAACACTC AGTCTGAAAG GCATCCAACA GTTCAAGTGT
TATAATGAGG ACTTTCTTGT GTGCAATGAT TGCCTGGTAG AACAGTAGAA ATTGCTTTCC CGCAAGTATT TGTCTTCTTT
CACATCTTGC AAATAAGATT AAGTTTGGTT TTTTAATCTC AGTGAGATAT AAGAGAACAA AGAACGCCCT TTATATGTTC
TTAAGAATTT CGAGAACTTC CACAGTTGAT TTCATGCGTT TGCAACGGTC ACATCATCTA TAATAGGTGT TGTAAATACT
TCAGGCGTCC TATTTATCCA TGCATTTGGA AGCTGGTATC AGTATACCAT GTATTCTGGT TACACTGGTC CTGCAAAGAT
TAAACGATGT ATTATTTGTT ATATGAAAAA TTGCCAAATC AACACCATGC ATTCTAAAAG TGGATTGTTT AGCTGGATAA
ATGTGCCATA CCAGAGAACC ATGACACAGT TAAAGTGATA TTTTTCCATC CATATAGTAG TTAATAAGGC ACCAATAATT
CTACATTGCA TCATAGTAAT ACTTTAGGCC CCTTTAGTCC GACCAATCTG GAATTTGCAC GTGTTTAACT CTGTAAAGCA
TTAGTTTATC CGTGTACACT TCTTAACTTT GCATAGTACA AATGCAGCTT TTTAATGTAT ATTCACCCAA GTATGACACT
GGTGGAAGAT TCTGGCCCAT TGTGCACGGG GGAACAATAT TTTCTCTGGT GCTGATGCAT GTTATTGCAA TTGGAGTATT
TGGATTGAAG AAACTTCCCC TTGCATCAAG TTTGCTGGTA CCTCTTCCAG TGCTGACCCT TCTGTTCAAT GAATACTGCC
GGAACAGATT TTTACCGATC TTCGAAGCAT ATTCTACTGA GGTAATGTGT TTTTCATTTT GTCCAAGGGT GCAATGTAAT
TCTCTTTGTG CAACTATGTA TCAAAACGAA CAACGCATCA TTCTGGTCCT TTTAGCTTAT CACTTCGATA GTTCGATTAG
ATATAATGTG TATTCACGTT CTACCTTTCG TGCTGCAGTC ATTGATAAAG AAAGACAGAG AAGAAGAGAG CAAACCAGAA
ATGGCAGAAT TCTTCAGCAA TCTTGTAAAT GCGTACTGTG ACCCGGCGAT GAAACCTATC CAACACTCCT CGAATTCAGA
TGAACGCACT ACACCTCTAT TGTCTTAGAT CCAGATAAGT AATAGCTTGC AGCCTTACTG TCATGGCGTG AATTTTGGTT
TGACACCGAT AATCAGGCAT ACAACAATAC ACCTGTGCTT CTTCTTGTGA TGTTACTGTT GTAAAGCATT ACTACATACT
TGACTGTGGA GTtgttgtgc atatttgatt tgtacatctt aatttgtgct tactgcgtag agatgaataa tgcattGCTC
CTTAATGAAG TGCTGTCAAT GCAAACCTGT GTGGGTTGTA CTTCTAGATA TGTCAAATCA CCTTTATTTG TTCCCTTCAA
ATTTTGTGTA TATGGATGTT CTTTTGCTTC AACCTATTCA GTAATGAGAT TATTTGGCAG TTGGAATGAT GTGATATTAG
TACTGATACA TTATTATCAG TTTATTTGAG TT

Locus: Os12g0582800

Loading...

Locus: Os12g0582800

Loading...