Os12t0583700-01

Locus

Os12g0583700

Description

TFIIIA-type zinc finger protein, Tolerance to salt and drought stresses

RAP-DB Gene Symbol Synonym(s)

ZFP252

RAP-DB Gene Name Synonym(s)

Zinc finger protein 252

CGSNL Gene Symbol

ZFP252

CGSNL Gene Name

ZINC FINGER PROTEIN 252

Oryzabase Gene Symbol Synonym(s)

RZF71, DLN263, OsDLN263

Oryzabase Gene Name Synonym(s)

DLN repressor 263, DLN motif protein 263

Transcript Evidence

AY219847 (Jiu Caiqing)

Protein Evidence

Q84L70

Literature

PMID: 18325341

Note

Manual Curation

February 1, 2021

Gene Ontology (GO)

Molecular Function: nucleic acid binding (GO:0003676)

Functional domain (InterPro)

Zinc finger C2H2 superfamily (IPR036236)

Zinc finger C2H2-type (IPR013087)

Expression Databases

TENOR (Os12t0583700-00)

Others

Oryzabase (8646)

KEGG (Os12t0583700-00)

Transcript

1004 bp

>Os12t0583700-01 TFIIIA-type zinc finger protein, Tolerance to salt and drought stresses
TCTCCTTCCATTTTTCTTGTGCACTTCTCTTTCCCTTGCAAGCTCAAGAAACCCAATTAA
TTAAGATAGTTGTGATCATCTCCAAGCTTAGCTAATTAAGCTACTAGTGGCCATGGCGGT
GGAGGCGGTTCTTGAGGCGTCGAGAAGTAGTAGTGAGGAGGAGGCGGAGGTGATCGTCAC
GCACGGCGGCGGCGGCGGCGGCGGAGGAGGAGGAGGACAGGTGGAGGGGTGGGGGAAGCG
GAAGCGGTCGCGGCGGCGGCGACCGCAGCTGCCGCCCTCCGAGGAGGAGTACCTCGCGCT
CTGCCTCCTCATGCTGGCGCGCGGGCGACGCGACGGCGACGACGTGGCGGCGTCGGCGTC
GGCGGCGGCGGCGGCGGTGGAGCACCGGTGCTCCGTCTGCGGCAAGGCGTTCGCGTCCTA
CCAGGCTCTCGGCGGCCACAAGGCCAGCCACCGGAAGCCGCCGCCGCCCGCCATGGTCGA
CGACGACGAGGTGGTGGTGGAGACGAAACCGGCGGCTATCGCGACGCCGTCCTCGTCGGC
GTCGGGCGTCTCCGGCGGCGGCGGCGGGAGGGCGCACGAGTGCAACGTGTGCGGCAAGGC
GTTCCCGACGGGGCAGGCGCTGGGCGGCCACAAGCGATGCCACTACGACGGCACGATCGG
CAGCGCCGCCGGCGCCGGCGCGTCCAAGCCGGCGGCGAAGACGACCGTGGCGGTGGCGGC
GAGCCGGGGCTTCGACCTCAACCTGCCGGCGCTGCCGGACGTCGCCGCCGCCGCCGACCA
GCGGTGCGCGGCGGAGGACGACGAGGTGCTCAGCCCTCTCGCCTTCAAGAAGCCCAGGCT
CATGATCCCGGCATAGCTAGCCAAGCCCACAAGATTTGTTTAATTTTAGCCATAAAATTC
CATTAAATTAAACCCATAGTTTTTTCTGTTAATTACTTTCTTAATTTGGTGATTAGTCTT
AGGAATGATGATTAGTTTGTGTATATAGCCATTGTTTGTTCATC

CDS

744 bp

>Os12t0583700-01 TFIIIA-type zinc finger protein, Tolerance to salt and drought stresses
ATGGCGGTGGAGGCGGTTCTTGAGGCGTCGAGAAGTAGTAGTGAGGAGGAGGCGGAGGTG
ATCGTCACGCACGGCGGCGGCGGCGGCGGCGGAGGAGGAGGAGGACAGGTGGAGGGGTGG
GGGAAGCGGAAGCGGTCGCGGCGGCGGCGACCGCAGCTGCCGCCCTCCGAGGAGGAGTAC
CTCGCGCTCTGCCTCCTCATGCTGGCGCGCGGGCGACGCGACGGCGACGACGTGGCGGCG
TCGGCGTCGGCGGCGGCGGCGGCGGTGGAGCACCGGTGCTCCGTCTGCGGCAAGGCGTTC
GCGTCCTACCAGGCTCTCGGCGGCCACAAGGCCAGCCACCGGAAGCCGCCGCCGCCCGCC
ATGGTCGACGACGACGAGGTGGTGGTGGAGACGAAACCGGCGGCTATCGCGACGCCGTCC
TCGTCGGCGTCGGGCGTCTCCGGCGGCGGCGGCGGGAGGGCGCACGAGTGCAACGTGTGC
GGCAAGGCGTTCCCGACGGGGCAGGCGCTGGGCGGCCACAAGCGATGCCACTACGACGGC
ACGATCGGCAGCGCCGCCGGCGCCGGCGCGTCCAAGCCGGCGGCGAAGACGACCGTGGCG
GTGGCGGCGAGCCGGGGCTTCGACCTCAACCTGCCGGCGCTGCCGGACGTCGCCGCCGCC
GCCGACCAGCGGTGCGCGGCGGAGGACGACGAGGTGCTCAGCCCTCTCGCCTTCAAGAAG
CCCAGGCTCATGATCCCGGCATAG

Protein

248 aa

>Os12t0583700-01 TFIIIA-type zinc finger protein, Tolerance to salt and drought stresses
MAVEAVLEASRSSSEEEAEVIVTHGGGGGGGGGGGQVEGWGKRKRSRRRRPQLPPSEEEY
LALCLLMLARGRRDGDDVAASASAAAAAVEHRCSVCGKAFASYQALGGHKASHRKPPPPA
MVDDDEVVVETKPAAIATPSSSASGVSGGGGGRAHECNVCGKAFPTGQALGGHKRCHYDG
TIGSAAGAGASKPAAKTTVAVAASRGFDLNLPALPDVAAAADQRCAAEDDEVLSPLAFKK
PRLMIPA*

5'UTR

chr12:24238269..24238380 (- strand) : 112 bp

CDS

chr12:24237525..24238268 (- strand) : 744 bp

3'UTR

chr12:24237377..24237524 (- strand) : 148 bp

FASTA

>Os12t0583700-01 class=Sequence position=chr12:24237377..24238380 (- strand)
TCTCCTTCCA TTTTTCTTGT GCACTTCTCT TTCCCTTGCA AGCTCAAGAA ACCCAATTAA TTAAGATAGT TGTGATCATC
TCCAAGCTTA GCTAATTAAG CTACTAGTGG CCATGGCGGT GGAGGCGGTT CTTGAGGCGT CGAGAAGTAG TAGTGAGGAG
GAGGCGGAGG TGATCGTCAC GCACGGCGGC GGCGGCGGCG GCGGAGGAGG AGGAGGACAG GTGGAGGGGT GGGGGAAGCG
GAAGCGGTCG CGGCGGCGGC GACCGCAGCT GCCGCCCTCC GAGGAGGAGT ACCTCGCGCT CTGCCTCCTC ATGCTGGCGC
GCGGGCGACG CGACGGCGAC GACGTGGCGG CGTCGGCGTC GGCGGCGGCG GCGGCGGTGG AGCACCGGTG CTCCGTCTGC
GGCAAGGCGT TCGCGTCCTA CCAGGCTCTC GGCGGCCACA AGGCCAGCCA CCGGAAGCCG CCGCCGCCCG CCATGGTCGA
CGACGACGAG GTGGTGGTGG AGACGAAACC GGCGGCTATC GCGACGCCGT CCTCGTCGGC GTCGGGCGTC TCCGGCGGCG
GCGGCGGGAG GGCGCACGAG TGCAACGTGT GCGGCAAGGC GTTCCCGACG GGGCAGGCGC TGGGCGGCCA CAAGCGATGC
CACTACGACG GCACGATCGG CAGCGCCGCC GGCGCCGGCG CGTCCAAGCC GGCGGCGAAG ACGACCGTGG CGGTGGCGGC
GAGCCGGGGC TTCGACCTCA ACCTGCCGGC GCTGCCGGAC GTCGCCGCCG CCGCCGACCA GCGGTGCGCG GCGGAGGACG
ACGAGGTGCT CAGCCCTCTC GCCTTCAAGA AGCCCAGGCT CATGATCCCG GCATAGCTAG CCAAGCCCAC AAGATTTGTT
TAATTTTAGC CATAAAATTC CATTAAATTA AACCCATAGT TTTTTCTGTT AATTACTTTC TTAATTTGGT GATTAGTCTT
AGGAATGATG ATTAGTTTGT GTATATAGCC ATTGTTTGTT CATC

Locus: Os12g0583700

Loading...

Locus: Os12g0583700

Loading...