Os12t0589000-00

Locus

Os12g0589000

Description

Similar to Helix-loop-helix DNA-binding domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsbHLH130, bHLH130, OsRSL9, RSL9, DLN264, OsDLN264

Oryzabase Gene Name Synonym(s)

basic helix-loop-helix protein 130, ROOT HAIR DEFECTIVE-SIX LIKE 9, DLN repressor 264, DLN motif protein 264

Transcript Evidence

ab initio prediction

Protein Evidence

Q2QMV9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Functional domain (InterPro)

Helix-loop-helix DNA-binding (IPR011598)

Basic helix-loop-helix leucine zipper transcription factor (IPR024097)

Basic helix-loop-helix leucine zipper transcription factor, plant (IPR024102)

Expression Databases

TENOR (Os12t0589000-00)

Others

Oryzabase (15408)

Transcript

915 bp

>Os12t0589000-00 Similar to Helix-loop-helix DNA-binding domain containing protein.
ATGGAGGGTGGAGGACTGATCGCCGATATGAGCTGGACCGTCTTCGACTTGCCATCGCAC
AGCGATGAGTCGGAGATGATGGCGCAGCTCTTCAGTGCATTCCCCATCCATGGTGAGGAG
GAAGGCCATGAGCAGCTCCCATGGTTTGATCAATCTTCCAATCCATGCTACTATAGCTGC
AATGCTAGCAGCACTGCATACAGCAACAGCAATGCTAGTAGCATTCCTGCTCCATCTGAG
TATGAAGGATACTGCTTCAGTGACTCAAATGAGGCCCTGGGTGTCAGCTCCAGCATTGCA
CCACATGACCTGAGCATGGTCCAGGTGCAAGGTGCAACTGAGTTTCTGAATGTGATCCCA
AACCATTCCCTTGATTCATTCGGTAATGGCGAGCTGGGCCACGAGGATCTTGATTCGGTT
AGTGGGACTAACAAGAGAAAACAGTCGGCAGAAGGAGAATTTGATGGCCAAACAAGAGGT
TCAAAATGCGCGAGAAAGGCTGAACCGAAGCGAGCGAAGAAGGCCAAGCAAACTGTGGAG
AAGGATGCAAGTGTTGCCATCCCAAATGGGAGCTGTTCCATTTCTGACAATGATTCCAGT
TCATCCCAGGAGGTTGCAGATGCTGGTGCTACTTCGAAAGGCAAATCCCGGGCTGGCCGC
GGAGCAGCCACTGATCCCCAGAGCCTCTATGCAAGGAAAAGGAGAGAGAGGATCAATGAG
AGGCTCAAGACACTTCAGAACCTTGTGCCCAATGGCACCAAAGTTGATATCAGCACCATG
CTTGAGGAGGCAGTCCACTATGTGAAGTTCCTGCAGCTTCAGATCAAGCTCCTCAGCTCC
GATGAAATGTGGATGTATGCGCCAATTGCGTACAACGGGATGAACATTGGGCTCGATCTG
AACATTGATACATGA

CDS

915 bp

>Os12t0589000-00 Similar to Helix-loop-helix DNA-binding domain containing protein.
ATGGAGGGTGGAGGACTGATCGCCGATATGAGCTGGACCGTCTTCGACTTGCCATCGCAC
AGCGATGAGTCGGAGATGATGGCGCAGCTCTTCAGTGCATTCCCCATCCATGGTGAGGAG
GAAGGCCATGAGCAGCTCCCATGGTTTGATCAATCTTCCAATCCATGCTACTATAGCTGC
AATGCTAGCAGCACTGCATACAGCAACAGCAATGCTAGTAGCATTCCTGCTCCATCTGAG
TATGAAGGATACTGCTTCAGTGACTCAAATGAGGCCCTGGGTGTCAGCTCCAGCATTGCA
CCACATGACCTGAGCATGGTCCAGGTGCAAGGTGCAACTGAGTTTCTGAATGTGATCCCA
AACCATTCCCTTGATTCATTCGGTAATGGCGAGCTGGGCCACGAGGATCTTGATTCGGTT
AGTGGGACTAACAAGAGAAAACAGTCGGCAGAAGGAGAATTTGATGGCCAAACAAGAGGT
TCAAAATGCGCGAGAAAGGCTGAACCGAAGCGAGCGAAGAAGGCCAAGCAAACTGTGGAG
AAGGATGCAAGTGTTGCCATCCCAAATGGGAGCTGTTCCATTTCTGACAATGATTCCAGT
TCATCCCAGGAGGTTGCAGATGCTGGTGCTACTTCGAAAGGCAAATCCCGGGCTGGCCGC
GGAGCAGCCACTGATCCCCAGAGCCTCTATGCAAGGAAAAGGAGAGAGAGGATCAATGAG
AGGCTCAAGACACTTCAGAACCTTGTGCCCAATGGCACCAAAGTTGATATCAGCACCATG
CTTGAGGAGGCAGTCCACTATGTGAAGTTCCTGCAGCTTCAGATCAAGCTCCTCAGCTCC
GATGAAATGTGGATGTATGCGCCAATTGCGTACAACGGGATGAACATTGGGCTCGATCTG
AACATTGATACATGA

Protein

305 aa

>Os12t0589000-00 Similar to Helix-loop-helix DNA-binding domain containing protein.
MEGGGLIADMSWTVFDLPSHSDESEMMAQLFSAFPIHGEEEGHEQLPWFDQSSNPCYYSC
NASSTAYSNSNASSIPAPSEYEGYCFSDSNEALGVSSSIAPHDLSMVQVQGATEFLNVIP
NHSLDSFGNGELGHEDLDSVSGTNKRKQSAEGEFDGQTRGSKCARKAEPKRAKKAKQTVE
KDASVAIPNGSCSISDNDSSSSQEVADAGATSKGKSRAGRGAATDPQSLYARKRRERINE
RLKTLQNLVPNGTKVDISTMLEEAVHYVKFLQLQIKLLSSDEMWMYAPIAYNGMNIGLDL
NIDT*

CDS

chr12:24633300..24633776 (- strand) : 477 bp

chr12:24632980..24633198 (- strand) : 219 bp

chr12:24632823..24632888 (- strand) : 66 bp

chr12:24632660..24632725 (- strand) : 66 bp

chr12:24632487..24632573 (- strand) : 87 bp

FASTA

>Os12t0589000-00 class=Sequence position=chr12:24632487..24633776 (- strand)
ATGGAGGGTG GAGGACTGAT CGCCGATATG AGCTGGACCG TCTTCGACTT GCCATCGCAC AGCGATGAGT CGGAGATGAT
GGCGCAGCTC TTCAGTGCAT TCCCCATCCA TGGTGAGGAG GAAGGCCATG AGCAGCTCCC ATGGTTTGAT CAATCTTCCA
ATCCATGCTA CTATAGCTGC AATGCTAGCA GCACTGCATA CAGCAACAGC AATGCTAGTA GCATTCCTGC TCCATCTGAG
TATGAAGGAT ACTGCTTCAG TGACTCAAAT GAGGCCCTGG GTGTCAGCTC CAGCATTGCA CCACATGACC TGAGCATGGT
CCAGGTGCAA GGTGCAACTG AGTTTCTGAA TGTGATCCCA AACCATTCCC TTGATTCATT CGGTAATGGC GAGCTGGGCC
ACGAGGATCT TGATTCGGTT AGTGGGACTA ACAAGAGAAA ACAGTCGGCA GAAGGAGAAT TTGATGGCCA AACAAGAGTA
AGTCCTTGCT CATCAGTGAT CATTCTTCAC TCTTGTTATC TTTCAGGAAG ATGTTTGGAG TGCTAATGTA AAAATCGCTT
GGAATGATCG AAATGCAGGG TTCAAAATGC GCGAGAAAGG CTGAACCGAA GCGAGCGAAG AAGGCCAAGC AAACTGTGGA
GAAGGATGCA AGTGTTGCCA TCCCAAATGG GAGCTGTTCC ATTTCTGACA ATGATTCCAG TTCATCCCAG GAGGTTGCAG
ATGCTGGTGC TACTTCGAAA GGCAAATCCC GGGCTGGCCG CGGAGCAGCC ACTGATCCCC AGAGCCTCTA TGCAAGGGTA
CTAGAACATG ATCATCTCCT GAAAACATAA TCTTTTCAAC AACTGAATGT GAAAAAAAAA TGCTAACATA AGTTCTCTGC
TTAATCAGAA AAGGAGAGAG AGGATCAATG AGAGGCTCAA GACACTTCAG AACCTTGTGC CCAATGGCAC CAAAGTAAGC
TTCTGAACAT AAGTGCTACC AATTACACTC ACATGACATG GAATTCTTGA ACCAAATGGC TAAAAGAACA ATGCTTGTCT
TGATCTTGTA GGTTGATATC AGCACCATGC TTGAGGAGGC AGTCCACTAT GTGAAGTTCC TGCAGCTTCA GATCAAGGTG
AGCATCTACA GAATACAGTT CAGTTCATAT CATCCATTAT CCTGTAACAA GATCCACTTA TCATATTTTG TCCAATCCTG
CAGCTCCTCA GCTCCGATGA AATGTGGATG TATGCGCCAA TTGCGTACAA CGGGATGAAC ATTGGGCTCG ATCTGAACAT
TGATACATGA 

Locus: Os12g0589000

Loading...

Locus: Os12g0589000

Loading...