Os12t0589400-01

Locus

Os12g0589400

Description

Domain of unknown function (DUF) 1618 protein, Gamete development, F1 and F2 hybrid sterility

RAP-DB Gene Symbol Synonym(s)

HSA1a, HSA1a-j

RAP-DB Gene Name Synonym(s)

hybrid sterility-a1a

CGSNL Gene Symbol

HSA1A

CGSNL Gene Name

F2 STERILITY-1

Oryzabase Gene Symbol Synonym(s)

hsa1(t), s(t), hst49

Oryzabase Gene Name Synonym(s)

F2 sterility-1(t)

Transcript Evidence

AK119349

Protein Evidence

Q2QMV6

Literature

PMID: 26455463

Note

Manual Curation

February 12, 2021

Functional domain (InterPro)

Domain of unknown function DUF1618 (IPR011676)

Full-length cDNA

001-131-E11 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0589400-01)

RiceXPro (AK119349)

Others

Oryzabase (2170)

KEGG (Os12t0589400-01)

Transcript

2839 bp

>Os12t0589400-01 Domain of unknown function (DUF) 1618 protein, Gamete development, F1 and F2 hybrid sterility
ATCGTGCCGCCGTCCCCTGGGTGGAGGCCGGCAAAACCCTAGATCATCTCACGGTGGCGA
CATGGAAGCGCATGGATGGATGGTCCTGGACCGCATTGTCCGCTGCTGGAGCGACGACGA
CGACGTCGTCGGCGGCGACGATGACCCCACGTCGTCGGAGGTCGCCTACACCTGCAGCGG
GCACCCCATCCGCGTCTCCCTCCGCGTCGCCGACCCCCCCGCCGTCTCCCGCCTCTACGT
CCACCGCCCCGGCTGGCCGCGCGTCTACGACCtgggcgacgccgaggccatcgccgccca
ccgcggatccatcctcctctcggcgcgcgtccccttcgccgacctcggcaccgtcgcgcc
gggCCAATTCCCCGTCGACTACTACGTCTACACCGCCGGCGAGGGGCTGCGGCGGCCATC
GCTCACGCGGCTGCCCCCTTGCTTCATCGGTGGATTCTCCTCCCCGGAGGTCGACCGCCA
CTTCAAGCCGCACCGGTGCCAGCAGCAGCGGGTCATGGTAGAGCAGAACGTCGGCTTCTT
CTGCCACGGCGCCGGCAATTTCACGGTGGCGGACATCAACATCCATAAGGGTAAGGCCGT
CGAGCTCTGCGTCCTCAACCACTATGCTGATTGCCCCCAACAACCCCAATGGAAGGTCCA
GATCCTGGAGATGCAGCAGCAACCCAACCAAAACCACCACCTCAGAGGTTGGTGGACCGA
CGCCGTTCTTCCCCTGCACGACAGCTACCTCGCCTGCGTCGACTGCTACCATGGCATCAT
CCTCATCGACGTCAAGACCCAGCGTTACTTCAACTACATACCGCTGCCGGCAGAGGCGAA
GCATGGCCGCCGCCGCGTTGACAAGTACAGCCCTGATCCAGCTCGTTCTGCCTCCATCAA
CAGCGCTGGCAATATCACGGTTGTCTGCATAGCCGACGACAATGCCGCAGCAGGAGGCCG
CAACAACAACAGCACTGCTGGCTCTGCTTTCATCGAGATCGAGTCATGGTGTCTGGTCGA
CATCCACGAAAGTAGATGGATTCTTGATTTCACTATGGAAGCCGGCAAGTTCTGGGATAT
TTGCTCTGCTGCAAACCAGCCCCTCCTTCCACATGCGCCGCCTACTTTCCCCCTGGTGAG
CATGGCTAATCCATTTGCCATCTCCTTCCTCCTCTACGACAAGGCCAACAACTTCCTCCT
CGAGGACAAGGGCAATGGCCTTTACTGGATGATTGAGGTAGACATGAGAAACCAAATCCT
GCTGTCACCAGCCACCCTCTACATCAGTGAAGAAGAAGAAGAGCTCTTCATCAATGGAAA
AGAAGAAGAGCAAGAAAGATGTTGTGATGAGAGATACCCGCCCATGAAATATTTTTATGG
CCATAACTTCATCCCCAGCTGGTTCCCCTCTTACTTGAAGAAAGGTGGCGACACCACAAG
GTTTGCTATGTTTTCTTTTTTATTTGTGATACAAAAACATTTACCATTTGTGTGATGTGT
TCAAATATGAAAATAATACCAGTTGGAATATCCATTCAATTGCTTTAGCCACTGTTTAGG
AATTAACAAGCAGATAACTGGATAGTTAAATGGCTGAGCAGTTAGCATATTGGAATAGAG
CATATCTTTATTAGCTAAATGACTTTGACGATTGGTTTGCTATGTTGTAACATGAGCATA
TTTGATCGAATGCCCTGCCAATCCTGCAAATAGTGATTCAAGCAATAACTCGGAATTATT
CTTCTGTACTCCTCTTCTATACTTGGACATTGCCTCTTAATTAAATTTTCATTACATTCA
TTTTTCTTTTCGCACAGTTAAACTAGTAGAGCCTTTCATTTGGTGAAAGTTTTACTGATT
TGCCAGCACATAACCTTAAGTAATTTGGTTAGCTAAGTTCTTGGTCTAATCAATTACCAA
CTGTAAACATCATAGCTTGATTTGAAGGAACATCGGGATTGCAGGATCAAAAACTACAGC
CTAAACTGTTACTGTTTCTTCTGCTGGAAAGCAAATATAATATTAGGCCTTAAGACAGAC
AGCCACAGAACAGTGCAGACTTTCTTAACTAGTGTGTCGCATTTGCTTATTTTCTTACCG
TCTGTATCTAGTTGCATTGATCGCCTTGTGACTTCTTTTCCATTTCTTGATGCAGTCGGC
TGCGGAGTTTAATGATGCAGCAGGCAAAACAAGAGAGTGTAATGCAAAAGATTGGACGGT
AATTAAGCACAATGAACAAGCTGTGTCCATGTTTTTTTATCTAGCCTGGAATTAGTTGCA
TTGCCAGGGTTTTCGGTTTCTTTCGGCCATTTTGGttttaccaaaattcctgaaatttcg
gttttctgcactttttggaccccattttttgaaattttaacataatttagctgattttga
ccaaattcgtaaaaaaaaagagagaccgaaaatttcgaccagataatcacttgccgaggg
atccgaaatttcgaaccgaaattacaatcAGTGTATATAGCTGTTGTCTGCCCATGCCAA
CTCCCGCAACATCGGAAGGCGTGACGAGGTGATCATGGCGTAGCTGAACAATCCAGCAAA
CCTTCGCACCCAACGCCTACTACCACGACAAGACAGACAGAGCGGTCGTCTCCCAGAGAA
CTTTTATTTTAGTTTTGGGTTTGATTATACAATCGGGTTTTAACCGTATGTAGGTTATGT
TCTTGATGGTGGTTTAAGATGTTTAACACTATAGGATGGGTTATAGTTCGATGTTAGAAT
TATTCCCGTACCTGGACTACTATTGTTTGATGTTGAATTTACAAGTTCAATATGATGTTT
TGCACAACTCATTTTAGTT

CDS

1434 bp

>Os12t0589400-01 Domain of unknown function (DUF) 1618 protein, Gamete development, F1 and F2 hybrid sterility
ATGGAAGCGCATGGATGGATGGTCCTGGACCGCATTGTCCGCTGCTGGAGCGACGACGAC
GACGTCGTCGGCGGCGACGATGACCCCACGTCGTCGGAGGTCGCCTACACCTGCAGCGGG
CACCCCATCCGCGTCTCCCTCCGCGTCGCCGACCCCCCCGCCGTCTCCCGCCTCTACGTC
CACCGCCCCGGCTGGCCGCGCGTCTACGACCtgggcgacgccgaggccatcgccgcccac
cgcggatccatcctcctctcggcgcgcgtccccttcgccgacctcggcaccgtcgcgccg
ggCCAATTCCCCGTCGACTACTACGTCTACACCGCCGGCGAGGGGCTGCGGCGGCCATCG
CTCACGCGGCTGCCCCCTTGCTTCATCGGTGGATTCTCCTCCCCGGAGGTCGACCGCCAC
TTCAAGCCGCACCGGTGCCAGCAGCAGCGGGTCATGGTAGAGCAGAACGTCGGCTTCTTC
TGCCACGGCGCCGGCAATTTCACGGTGGCGGACATCAACATCCATAAGGGTAAGGCCGTC
GAGCTCTGCGTCCTCAACCACTATGCTGATTGCCCCCAACAACCCCAATGGAAGGTCCAG
ATCCTGGAGATGCAGCAGCAACCCAACCAAAACCACCACCTCAGAGGTTGGTGGACCGAC
GCCGTTCTTCCCCTGCACGACAGCTACCTCGCCTGCGTCGACTGCTACCATGGCATCATC
CTCATCGACGTCAAGACCCAGCGTTACTTCAACTACATACCGCTGCCGGCAGAGGCGAAG
CATGGCCGCCGCCGCGTTGACAAGTACAGCCCTGATCCAGCTCGTTCTGCCTCCATCAAC
AGCGCTGGCAATATCACGGTTGTCTGCATAGCCGACGACAATGCCGCAGCAGGAGGCCGC
AACAACAACAGCACTGCTGGCTCTGCTTTCATCGAGATCGAGTCATGGTGTCTGGTCGAC
ATCCACGAAAGTAGATGGATTCTTGATTTCACTATGGAAGCCGGCAAGTTCTGGGATATT
TGCTCTGCTGCAAACCAGCCCCTCCTTCCACATGCGCCGCCTACTTTCCCCCTGGTGAGC
ATGGCTAATCCATTTGCCATCTCCTTCCTCCTCTACGACAAGGCCAACAACTTCCTCCTC
GAGGACAAGGGCAATGGCCTTTACTGGATGATTGAGGTAGACATGAGAAACCAAATCCTG
CTGTCACCAGCCACCCTCTACATCAGTGAAGAAGAAGAAGAGCTCTTCATCAATGGAAAA
GAAGAAGAGCAAGAAAGATGTTGTGATGAGAGATACCCGCCCATGAAATATTTTTATGGC
CATAACTTCATCCCCAGCTGGTTCCCCTCTTACTTGAAGAAAGGTGGCGACACCACAAGG
TTTGCTATGTTTTCTTTTTTATTTGTGATACAAAAACATTTACCATTTGTGTGA

Protein

477 aa

>Os12t0589400-01 Domain of unknown function (DUF) 1618 protein, Gamete development, F1 and F2 hybrid sterility
MEAHGWMVLDRIVRCWSDDDDVVGGDDDPTSSEVAYTCSGHPIRVSLRVADPPAVSRLYV
HRPGWPRVYDLGDAEAIAAHRGSILLSARVPFADLGTVAPGQFPVDYYVYTAGEGLRRPS
LTRLPPCFIGGFSSPEVDRHFKPHRCQQQRVMVEQNVGFFCHGAGNFTVADINIHKGKAV
ELCVLNHYADCPQQPQWKVQILEMQQQPNQNHHLRGWWTDAVLPLHDSYLACVDCYHGII
LIDVKTQRYFNYIPLPAEAKHGRRRVDKYSPDPARSASINSAGNITVVCIADDNAAAGGR
NNNSTAGSAFIEIESWCLVDIHESRWILDFTMEAGKFWDICSAANQPLLPHAPPTFPLVS
MANPFAISFLLYDKANNFLLEDKGNGLYWMIEVDMRNQILLSPATLYISEEEEELFINGK
EEEQERCCDERYPPMKYFYGHNFIPSWFPSYLKKGGDTTRFAMFSFLFVIQKHLPFV*

5'UTR

chr12:24646431..24646491 (+ strand) : 61 bp

CDS

chr12:24646492..24647925 (+ strand) : 1434 bp

3'UTR

chr12:24647926..24649269 (+ strand) : 1344 bp

FASTA

>Os12t0589400-01 class=Sequence position=chr12:24646431..24649269 (+ strand)
ATCGTGCCGC CGTCCCCTGG GTGGAGGCCG GCAAAACCCT AGATCATCTC ACGGTGGCGA CATGGAAGCG CATGGATGGA
TGGTCCTGGA CCGCATTGTC CGCTGCTGGA GCGACGACGA CGACGTCGTC GGCGGCGACG ATGACCCCAC GTCGTCGGAG
GTCGCCTACA CCTGCAGCGG GCACCCCATC CGCGTCTCCC TCCGCGTCGC CGACCCCCCC GCCGTCTCCC GCCTCTACGT
CCACCGCCCC GGCTGGCCGC GCGTCTACGA CCtgggcgac gccgaggcca tcgccgccca ccgcggatcc atcctcctct
cggcgcgcgt ccccttcgcc gacctcggca ccgtcgcgcc gggCCAATTC CCCGTCGACT ACTACGTCTA CACCGCCGGC
GAGGGGCTGC GGCGGCCATC GCTCACGCGG CTGCCCCCTT GCTTCATCGG TGGATTCTCC TCCCCGGAGG TCGACCGCCA
CTTCAAGCCG CACCGGTGCC AGCAGCAGCG GGTCATGGTA GAGCAGAACG TCGGCTTCTT CTGCCACGGC GCCGGCAATT
TCACGGTGGC GGACATCAAC ATCCATAAGG GTAAGGCCGT CGAGCTCTGC GTCCTCAACC ACTATGCTGA TTGCCCCCAA
CAACCCCAAT GGAAGGTCCA GATCCTGGAG ATGCAGCAGC AACCCAACCA AAACCACCAC CTCAGAGGTT GGTGGACCGA
CGCCGTTCTT CCCCTGCACG ACAGCTACCT CGCCTGCGTC GACTGCTACC ATGGCATCAT CCTCATCGAC GTCAAGACCC
AGCGTTACTT CAACTACATA CCGCTGCCGG CAGAGGCGAA GCATGGCCGC CGCCGCGTTG ACAAGTACAG CCCTGATCCA
GCTCGTTCTG CCTCCATCAA CAGCGCTGGC AATATCACGG TTGTCTGCAT AGCCGACGAC AATGCCGCAG CAGGAGGCCG
CAACAACAAC AGCACTGCTG GCTCTGCTTT CATCGAGATC GAGTCATGGT GTCTGGTCGA CATCCACGAA AGTAGATGGA
TTCTTGATTT CACTATGGAA GCCGGCAAGT TCTGGGATAT TTGCTCTGCT GCAAACCAGC CCCTCCTTCC ACATGCGCCG
CCTACTTTCC CCCTGGTGAG CATGGCTAAT CCATTTGCCA TCTCCTTCCT CCTCTACGAC AAGGCCAACA ACTTCCTCCT
CGAGGACAAG GGCAATGGCC TTTACTGGAT GATTGAGGTA GACATGAGAA ACCAAATCCT GCTGTCACCA GCCACCCTCT
ACATCAGTGA AGAAGAAGAA GAGCTCTTCA TCAATGGAAA AGAAGAAGAG CAAGAAAGAT GTTGTGATGA GAGATACCCG
CCCATGAAAT ATTTTTATGG CCATAACTTC ATCCCCAGCT GGTTCCCCTC TTACTTGAAG AAAGGTGGCG ACACCACAAG
GTTTGCTATG TTTTCTTTTT TATTTGTGAT ACAAAAACAT TTACCATTTG TGTGATGTGT TCAAATATGA AAATAATACC
AGTTGGAATA TCCATTCAAT TGCTTTAGCC ACTGTTTAGG AATTAACAAG CAGATAACTG GATAGTTAAA TGGCTGAGCA
GTTAGCATAT TGGAATAGAG CATATCTTTA TTAGCTAAAT GACTTTGACG ATTGGTTTGC TATGTTGTAA CATGAGCATA
TTTGATCGAA TGCCCTGCCA ATCCTGCAAA TAGTGATTCA AGCAATAACT CGGAATTATT CTTCTGTACT CCTCTTCTAT
ACTTGGACAT TGCCTCTTAA TTAAATTTTC ATTACATTCA TTTTTCTTTT CGCACAGTTA AACTAGTAGA GCCTTTCATT
TGGTGAAAGT TTTACTGATT TGCCAGCACA TAACCTTAAG TAATTTGGTT AGCTAAGTTC TTGGTCTAAT CAATTACCAA
CTGTAAACAT CATAGCTTGA TTTGAAGGAA CATCGGGATT GCAGGATCAA AAACTACAGC CTAAACTGTT ACTGTTTCTT
CTGCTGGAAA GCAAATATAA TATTAGGCCT TAAGACAGAC AGCCACAGAA CAGTGCAGAC TTTCTTAACT AGTGTGTCGC
ATTTGCTTAT TTTCTTACCG TCTGTATCTA GTTGCATTGA TCGCCTTGTG ACTTCTTTTC CATTTCTTGA TGCAGTCGGC
TGCGGAGTTT AATGATGCAG CAGGCAAAAC AAGAGAGTGT AATGCAAAAG ATTGGACGGT AATTAAGCAC AATGAACAAG
CTGTGTCCAT GTTTTTTTAT CTAGCCTGGA ATTAGTTGCA TTGCCAGGGT TTTCGGTTTC TTTCGGCCAT TTTGGtttta
ccaaaattcc tgaaatttcg gttttctgca ctttttggac cccatttttt gaaattttaa cataatttag ctgattttga
ccaaattcgt aaaaaaaaag agagaccgaa aatttcgacc agataatcac ttgccgaggg atccgaaatt tcgaaccgaa
attacaatcA GTGTATATAG CTGTTGTCTG CCCATGCCAA CTCCCGCAAC ATCGGAAGGC GTGACGAGGT GATCATGGCG
TAGCTGAACA ATCCAGCAAA CCTTCGCACC CAACGCCTAC TACCACGACA AGACAGACAG AGCGGTCGTC TCCCAGAGAA
CTTTTATTTT AGTTTTGGGT TTGATTATAC AATCGGGTTT TAACCGTATG TAGGTTATGT TCTTGATGGT GGTTTAAGAT
GTTTAACACT ATAGGATGGG TTATAGTTCG ATGTTAGAAT TATTCCCGTA CCTGGACTAC TATTGTTTGA TGTTGAATTT
ACAAGTTCAA TATGATGTTT TGCACAACTC ATTTTAGTT

Locus: Os12g0589400

Loading...

Locus: Os12g0589400

Loading...