Os12t0596000-02

Locus

Os12g0596000

Description

Similar to Lipoyltransferase (EC 2.3.1.-) (Lipoyl-[acyl-carrier protein]-protein- N-lipoyltransferase) (Lipoate-protein ligase B).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ALDH12B1

CGSNL Gene Name

ALDEHYDE DEHYDROGENASE 12B1

Oryzabase Gene Symbol Synonym(s)

OsALDH12B1

Oryzabase Gene Name Synonym(s)

Aldehyde dehydrogenase 12B1

Transcript Evidence

AK073530 (DDBJ, Best hit)

AK101541 (DDBJ, Best hit)

Protein Evidence

B6U7E2 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J033046M10 (Online Clone Ordering)

J033048H21 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0596000-02)

RiceXPro (AK073530)

Others

Oryzabase (22116)

KEGG (Os12t0596000-02 (EC:2.3.1.181))

Transcript

2060 bp

>Os12t0596000-02 Similar to Lipoyltransferase (EC 2.3.1.-) (Lipoyl-[acyl-carrier protein]-protein- N-lipoyltransferase) (Lipoate-protein ligase B).
AGACGGCCgccatggccttctcctcctcgcctcctcggtgactccgcccgccgccgctgg
ctgccggcgcagcgccaccctacaagtcaccgccccaccgcgagaggagggcgggcatgg
ccttgccctgctcctatggctcccactgcgccgccctgcccttccccgccgtggtctcca
gggcggcctcctcgccgccaccgcgctcccGGGGGAGAAGGCCCAGCCTACCACCCGCCG
GATGCTTCCACGCCGCGCCAAGGGACGCCGCTCTGGTGTCCGGCTCCGCTGCTGGTGGCG
TGAGCAGGAGGAGGTGTGAGTTATTTGACCTCCATCAGCACATCGTTCCATTTGCGGAAT
CTTGGGCTTGGCAGCAGTCCATTGTGACAAGGAGGAAAGGGTTGGTAGGCACGGATGAAG
ATCACTCCGACACCTTAATCGCGCTGCAGCATCCACCAGTTTATACGCTAGGCACTGACA
GCACCGAGGACTACCTCCATTTCGATGTTAAAGATGCTCCTTTTGAGGTTCACCGTATTG
ACCGTGGTGGGGAGGTGACATATCATGGTCCTGGACAGCTTGTAATGTACCCGATTATCA
ACTTGCGATATCATCAAATGGACCTTCATTGGTACTTTAGATCACTTGAAGAGGTGATCA
TTCGTGCCCTTCAGTCCGCATTTTCCATCAAGGCATCTAGGGTAGAAGGTCTAACCGGTG
TCTGGGTTGGAGATAAGAAAGTTGCAGCAATAGGAATTCATGTCTCACGATGGATAGCAT
ATCATGGTCTAGCACTCAACGTAACCACTGACTTAACACCATTTCAACTCATTGTTCCCT
GCGGCATAAAAGATCGTGGCGTTGGGAGCATCAAAGAGATATTGCAAATAGCATCTGATG
GAAAAGAGATAGACGAAACAGCATTGATCGATAAAGCCTACAGAACCCTGCTTAAAGAGT
TTGCTGAAGTTTTCCAGCTCTCTTTATATCACAACCCTAACTGGGATCTTCAGGAAAGCA
AAAATTTTAGTTAACTGCAGAATATTTTATTGGATTCTTGAAATTCAACTTGCATTGAAG
TCAGAAACCAGTACAGGTGGATAGAGAGGCAAACATAATTAGATCAAAGTGAAGTCTCCT
TCACTCTAATATCACCAAAACTGCAGAACTAGTCATCCATGTGCGCAAGCTCAAACTTTT
GCTTCACCTGCCAATCAGATAACGCTATCAGTTTTGAAGATGATGGTAATATGTAGGAGA
GGTGAGAAGTTCAGCCAAGCCAATTAACCTTCtgttaggagccatgtgggctgcaatatg
ggctggatcagctactttccaaagaagtccaagcaagcccaagaggcaaccatatataag
tagcagtagcacttctaggaggggacgaacagattgattggccaaggcggcgaacggcgg
cggcggcgacctggaggctggctggcctctttgtcgatctctcctctatctcccttcttc
tctactagtctagaagctactagaaccttctagcccttgtatccttccatcttccacctc
aaaaccactccactattgtaacagacttggttgttccctgtgttggatttggcactgcta
tttctgaaattacattgttggtgggtctctaacaCCTTCTTTGGGGTTCGAAGTGGATCC
ATCTGCCTTTGTGTCAACACCCGGCCATGGCTTGCAAGTACAATGTTTCCCCTTCTCGAT
ACCGTCGTAAACGGATGCGACATGTTTACCACATCCATTCCAGGTGAACTTGCCACATTT
GCTGCATTCCACCTTGAAGCACATCCTGTGCTCTTCTTCAGGTGCTCCTTTGGTGCGTGG
TGGGCAGTGGCAAATGTTGGGATGTTCTTTTGGATAGGTTCCTCTGGTCTTCATGGATTT
CAGCATTTTATAGCATCATATGCTGTTCTTCTTCTGAAGGAACAATGTACAAATACCCTA
TATATGCTGTTCAATGTAGTCTTTGACTCTTTGGTGATGGATACAATGTATGGATAATGT
GTAAAATCTTGCAGTTAGTG

CDS

918 bp

>Os12t0596000-02 Similar to Lipoyltransferase (EC 2.3.1.-) (Lipoyl-[acyl-carrier protein]-protein- N-lipoyltransferase) (Lipoate-protein ligase B).
atggccttgccctgctcctatggctcccactgcgccgccctgcccttccccgccgtggtc
tccagggcggcctcctcgccgccaccgcgctcccGGGGGAGAAGGCCCAGCCTACCACCC
GCCGGATGCTTCCACGCCGCGCCAAGGGACGCCGCTCTGGTGTCCGGCTCCGCTGCTGGT
GGCGTGAGCAGGAGGAGGTGTGAGTTATTTGACCTCCATCAGCACATCGTTCCATTTGCG
GAATCTTGGGCTTGGCAGCAGTCCATTGTGACAAGGAGGAAAGGGTTGGTAGGCACGGAT
GAAGATCACTCCGACACCTTAATCGCGCTGCAGCATCCACCAGTTTATACGCTAGGCACT
GACAGCACCGAGGACTACCTCCATTTCGATGTTAAAGATGCTCCTTTTGAGGTTCACCGT
ATTGACCGTGGTGGGGAGGTGACATATCATGGTCCTGGACAGCTTGTAATGTACCCGATT
ATCAACTTGCGATATCATCAAATGGACCTTCATTGGTACTTTAGATCACTTGAAGAGGTG
ATCATTCGTGCCCTTCAGTCCGCATTTTCCATCAAGGCATCTAGGGTAGAAGGTCTAACC
GGTGTCTGGGTTGGAGATAAGAAAGTTGCAGCAATAGGAATTCATGTCTCACGATGGATA
GCATATCATGGTCTAGCACTCAACGTAACCACTGACTTAACACCATTTCAACTCATTGTT
CCCTGCGGCATAAAAGATCGTGGCGTTGGGAGCATCAAAGAGATATTGCAAATAGCATCT
GATGGAAAAGAGATAGACGAAACAGCATTGATCGATAAAGCCTACAGAACCCTGCTTAAA
GAGTTTGCTGAAGTTTTCCAGCTCTCTTTATATCACAACCCTAACTGGGATCTTCAGGAA
AGCAAAAATTTTAGTTAA

Protein

306 aa

>Os12t0596000-02 Similar to Lipoyltransferase (EC 2.3.1.-) (Lipoyl-[acyl-carrier protein]-protein- N-lipoyltransferase) (Lipoate-protein ligase B).
MALPCSYGSHCAALPFPAVVSRAASSPPPRSRGRRPSLPPAGCFHAAPRDAALVSGSAAG
GVSRRRCELFDLHQHIVPFAESWAWQQSIVTRRKGLVGTDEDHSDTLIALQHPPVYTLGT
DSTEDYLHFDVKDAPFEVHRIDRGGEVTYHGPGQLVMYPIINLRYHQMDLHWYFRSLEEV
IIRALQSAFSIKASRVEGLTGVWVGDKKVAAIGIHVSRWIAYHGLALNVTTDLTPFQLIV
PCGIKDRGVGSIKEILQIASDGKEIDETALIDKAYRTLLKEFAEVFQLSLYHNPNWDLQE
SKNFS*

5'UTR

chr12:25032210..25032325 (- strand) : 116 bp

CDS

chr12:25032013..25032209 (- strand) : 197 bp

chr12:25031368..25031632 (- strand) : 265 bp

chr12:25030798..25030948 (- strand) : 151 bp

chr12:25030396..25030700 (- strand) : 305 bp

3'UTR

chr12:25029789..25030395 (- strand) : 607 bp

chr12:25026616..25027034 (- strand) : 419 bp

FASTA

>Os12t0596000-02 class=Sequence position=chr12:25026616..25032325 (- strand)
AGACGGCCgc catggccttc tcctcctcgc ctcctcggtg actccgcccg ccgccgctgg ctgccggcgc agcgccaccc
tacaagtcac cgccccaccg cgagaggagg gcgggcatgg ccttgccctg ctcctatggc tcccactgcg ccgccctgcc
cttccccgcc gtggtctcca gggcggcctc ctcgccgcca ccgcgctccc GGGGGAGAAG GCCCAGCCTA CCACCCGCCG
GATGCTTCCA CGCCGCGCCA AGGGACGCCG CTCTGGTGTC CGGCTCCGCT GCTGGTGGCG TGAGCAGGAG GAGGTTTGGT
GCCCCGTGAA TCTCCTAGTA TACCTAGTTT CTTTCGAATG CCTAATTTAT TGCTCCAAAT GGGAAGGAAG AAACCGTGTC
AGTGTCGTTG TTTCGATTGT ATTAGTTGAT GATGTATTTC TGGTTTATGA TTTGATTTAA CCGGTCTTGC TGGTCATTCG
GTTGAATTCA TCAGCACGAA CAATCCACAA ATGGCTTTGT TTTGCTCAAA GAGTTGTTCT GTACAAACTT TAGAACTCTC
AAAGCTTCAC TGTTTTTTGG GAAGCAGCAA ACTGAATTTG AACCTGATGT GTAGTAGAAT TGTGGCATTC TACTAGAAAA
TTGTGTTGCC TGCTTGCCAC TGATTGTTCT GACTATGTGG TTGTATTCAA CAGGTGTGAG TTATTTGACC TCCATCAGCA
CATCGTTCCA TTTGCGGAAT CTTGGGCTTG GCAGCAGTCC ATTGTGACAA GGAGGAAAGG GTTGGTAGGC ACGGATGAAG
ATCACTCCGA CACCTTAATC GCGCTGCAGC ATCCACCAGT TTATACGCTA GGCACTGACA GCACCGAGGA CTACCTCCAT
TTCGATGTTA AAGATGCTCC TTTTGAGGTT CACCGTATTG ACCGTGGTGG GGAGGTGACA TATCATGGTC CTGGACAGGT
ATGTACCATA ATGTCAGTGA AGCTCATATT GTTACATATC ACGAATCGTG GTTCATTTCT TTTACTTGTG AATAAGCTGT
ATGGTTCTCC ATTATCATCT AGACATCTAG TTATAGATAG TTAAAACTTC AAGTATAGGC CTAGCTGTGC AATCTGGTTA
CCAGAATGTG ATGAAATCTT GATTTTCACT AAGGCAGAAG ATTGTGGCTT GTTTTGCTAC AATTTATGAT GTATTCTACC
TAGTTAAACT TCATGTATAT CCCTAGCTGT GGTTAATCTG GTTATCAAAA TATGTGATAA AATCCTGGTT TTCCCGGAAG
ATTGTGGCTT CGATTCCTAT TGGATACTCA ATCTTTGCAT GAAATTCGTT TATAGCTAAT ATCTGTGCTT CTGACAGTCA
TTTTATTGTC TCCTTAGCTT GTAATGTACC CGATTATCAA CTTGCGATAT CATCAAATGG ACCTTCATTG GTACTTTAGA
TCACTTGAAG AGGTGATCAT TCGTGCCCTT CAGTCCGCAT TTTCCATCAA GGCATCTAGG GTAGAAGGTC TAACCGGTGT
CTGGGTTGGT ATGGTACTAT CCTTTTGGAA ATTGTGATAT TATTTTGAAT TTTCTGTGAG ATATAATGAC GTGTTACTAA
TATATCCCCT CTATTTACTT TTTAGGAGAT AAGAAAGTTG CAGCAATAGG AATTCATGTC TCACGATGGA TAGCATATCA
TGGTCTAGCA CTCAACGTAA CCACTGACTT AACACCATTT CAACTCATTG TTCCCTGCGG CATAAAAGAT CGTGGCGTTG
GGAGCATCAA AGAGATATTG CAAATAGCAT CTGATGGAAA AGAGATAGAC GAAACAGCAT TGATCGATAA AGCCTACAGA
ACCCTGCTTA AAGAGTTTGC TGAAGTTTTC CAGCTCTCTT TATATCACAA CCCTAACTGG GATCTTCAGG AAAGCAAAAA
TTTTAGTTAA CTGCAGAATA TTTTATTGGA TTCTTGAAAT TCAACTTGCA TTGAAGTCAG AAACCAGTAC AGGTGGATAG
AGAGGCAAAC ATAATTAGAT CAAAGTGAAG TCTCCTTCAC TCTAATATCA CCAAAACTGC AGAACTAGTC ATCCATGTGC
GCAAGCTCAA ACTTTTGCTT CACCTGCCAA TCAGATAACG CTATCAGTTT TGAAGATGAT GGTAATATGT AGGAGAGGTG
AGAAGTTCAG CCAAGCCAAT TAACCTTCtg ttaggagcca tgtgggctgc aatatgggct ggatcagcta ctttccaaag
aagtccaagc aagcccaaga ggcaaccata tataagtagc agtagcactt ctaggagggg acgaacagat tgattggcca
aggcggcgaa cggcggcggc ggcgacctgg aggctggctg gcctctttgt cgatctctcc tctatctccc ttcttctcta
ctagtctaga agctactaga accttctagc ccttgtatcc ttccatcttc cacctcaaaa ccactccact attgtaacag
acttggttgt tccctgtgtt ggatttggca ctgctatttc tgaaattaca ttgttgggtg ggtctctaac aatctggtat
cagagccaac aatccccact gagttcacca agcaagctgc catggcaagt gaacataagt tggatatgat tttgaggcga
atggaggagt ttgaacgaag gcgggtggag gcagagcaga caaggagagc tgatttccaa tctctcaagg cagcgttagc
atcatggatt ccccatgtac agaataacac tgaagactca cattttttgg ttggaaacaa gcagtacaag atgacgccca
ctatgtgttc gacagaatgc ttcagcccca atgtcgagcc caatctcgct gttgatgtgg ttgttacgtg tgccaccact
tctatgacct ctgttgatct ggtatctgct gaggacgcaa tcggtgcaac ctacatctac aatcctgtac agcccatggt
aacgcccgcc aagtgtttga caaattgctc caaccccaat aacatcccag acctcaccgt ggcagcagtg gttacgtgca
cctccacttc tctggcctcc atggacctgg aagttggtaa ggacgtcgcc tgcaccactg aaattgatgg ccctgactgt
cacaaggaga cgcacaccaa atgttcgatg ttaggccttg atgtcaaggg tggcgcagac cacgtcgggg gcgtgttcct
gacaatgtca ggtgtggcca agtctgttcc aatatctatc gagtcaattg acatcttctc agcaaggttg gtcagcgacc
tcaagcagga cataccaaca cccaccgggt gtttgttgag aatccctcga tatgacagca agacacagtt caataaaaag
ctaaggctgg aggggattga attgaagcca tggccacctc caacctacag tggagtgatt agcggactgg agttccgacc
aatgccctgg ccagcattca tctattgttg gcttgaagaa catctacttg atccttggcc accaccaact gaatgggctg
agttggaact gtggccccca ccacatgaga atgacatcct gcccttattg atcaatggct tcacccatat cctggtggat
cgaaaagcaa tttcaaaatt ctggaaagcg atttggagtg agttaggtga agaatggtca ttgtttgttc ctaagctata
tgagctgcac ttgagtggtc tccttcagca ttcagtaagc atgatatcac aacagcttat gtcaaggagg atatggtcca
ctaaggctaa aatgaagatg ttgaatggtt gggattctaa acagtacctg agcattatgc ggcctattcc aggattgttt
gttaaactta tccaagatat atctccaaag agccatcatc aagcttatat agaagctcaa gttgctaaaa aattcttgga
aaactttggt gaagataagg tacacttttt ggctcaatca attgctgtac ctgacactca ccttggacaa ggctgtattg
gctgttgttg gttgtatggc ccaaatgcaa ttagcacatt ccatttacta atagccatac tgcatattgt gagaccactt
tacatggaaa atattttcac taggacttca catgtagcaa agaaatgggc taaagacttg aaaggtgttg tgtttgattg
gaatacactg ggtatagtgg ttcaagaggt caattacatt gaattgatct gtgaccggga ttcgtatggt tgtagtgttc
agaagtgcta tcctcagtct attctattca tgcacaatgg ttggtctttt ggtggattgc ttgattggaa ctctaaacaa
tacaagaaca gtatgctaat tgtgaaccca ttggaactca tgcaagtact gttagtgcca ttagtgtggg atccagatgc
tgagatgggt cagattggta gctacgctct acaaccagaa aattgtcaat taactacctg catgagagca cattgcatta
agccaagtga ttatgagatc atcactgcca aagaaaacca tgctgctgat gctcctagac tgcttattgt tgtaatggag
gatgaaggca atacagtttg gactttagaa ttttcagtca gtggagtggt acagaagaag cgtgatcttt ggttgtgtgc
atttgctgtt aacaaggaca tgaaggttgt tatgttcctg cagcaatatg gttatgcaaa cttagtaatt gtcaatttat
tgagtgttcc atgggatcca ggcggctctc atttggcatt agctattaaa caaggaacta ggctttcact gtgggctatt
acaagcattg gctggttgtg tttcctatgg tcatattggc tacattacaa gagaaatagt aacaggggag atcaagtggg
tgaagcttgc acagcttcga gtcatcggct tggggacaag ccgaatttca agggaaggag aatgttagga gccatgtggg
ctgcaatatg ggctggatca gctactttcc aagaagtcca agcaagccca agaggcaacc atatataagt agcagcagca
cttccaggag gggacgaaca gattgattgg ccaaggcggc gaacggcggc ggcggcgacc tggaggctgg ctggcctctt
tgtcgatctc tcctctatct cccttcttct ctactagtct agaagctact agaaccttct agcccttgta tccttccatc
ttccacctca aaaccactcc actattgtaa cagacttggc tgttccctgt gttggatttg gcactgctat ttctgaaatt
acattgttga gtgggtctct aacaCCTTCT TTGGGGTTCG AAGTGGATCC ATCTGCCTTT GTGTCAACAC CCGGCCATGG
CTTGCAAGTA CAATGTTTCC CCTTCTCGAT ACCGTCGTAA ACGGATGCGA CATGTTTACC ACATCCATTC CAGGTGAACT
TGCCACATTT GCTGCATTCC ACCTTGAAGC ACATCCTGTG CTCTTCTTCA GGTGCTCCTT TGGTGCGTGG TGGGCAGTGG
CAAATGTTGG GATGTTCTTT TGGATAGGTT CCTCTGGTCT TCATGGATTT CAGCATTTTA TAGCATCATA TGCTGTTCTT
CTTCTGAAGG AACAATGTAC AAATACCCTA TATATGCTGT TCAATGTAGT CTTTGACTCT TTGGTGATGG ATACAATGTA
TGGATAATGT GTAAAATCTT GCAGTTAGTG 

Locus: Os12g0596000

Loading...

Locus: Os12g0596000

Loading...