Os12t0597000-01

Locus

Os12g0597000

Description

Similar to Calcineurin B-like protein 2 (SOS3-like calcium binding protein 1).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CBL2

CGSNL Gene Name

CALCINEURIN B-LIKE PROTEIN 2

Oryzabase Gene Symbol Synonym(s)

OsCBL2

Oryzabase Gene Name Synonym(s)

Calcineurin B-like protein 2

Transcript Evidence

AK111887 (DDBJ, Best hit)

Protein Evidence

Q3HRP5 (UniProt)

Literature

Note

  • Exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: calcium ion binding (GO:0005509)

Functional domain (InterPro)

Recoverin (IPR001125)

Calcium-binding EF-hand (IPR002048)

EF-hand-like domain (IPR011992)

EF-HAND 2 (IPR018249)

Full-length cDNA

J033068L17 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0597000-01)

Others

Oryzabase (6099)

Transcript

1508 bp

>Os12t0597000-01 Similar to Calcineurin B-like protein 2 (SOS3-like calcium binding protein 1).
AGACGCACGCGCACACGCATACGCATCGCAGCCAGTTCATCCTCGATTCCTCCCCCGAAT
TTCCTTCGCGATCTCACCCCGCGTGCCCTAGCTAGCTATCGAATCCCGTCACCTCGGCGG
CGGCGGCGAGATCGGAGCTCCGGGTTAACCTCCTCCACCGCGAGGCGTGGAACCTCTCTC
TCTCTCGCTCTCTCCACCTGAGGATCGAAGATCGAAACCCCTGGCACCGGCTCGGGCCGC
GGAATGGGCGGCCGCGGTGAGTAGCTAGGTCTGCGGCGGCGGAGTTGTTGTTGTTGGTGG
TGGTGGTGGTGGAGGAGGAGTTGGCGGCGGAGGGGGCGGGGGCGTTGGTGGTGGTGGTGG
TGGGAGAGTATCATGGTGCAGTGTCTCGACGGGGTGAGGCAgctgctggcggtcgtgttc
aagtgctgcgacctcgagctgaagcagccgcgggggCTCGAGGATCCCCAGGTCCTCGCG
AGGGAGACCGTCTTCAGCGTGAGCGAGGTCGAGGCGCTGTACGAGCTCTTCAAGAAGATA
AGCAGTGCTGTGATTGATGACGGGCTGATTAACAAGGAGGAGTTTCAGTTGGCGCTGTTC
AAGACCAGCAAGAAGGAGAGCCTGTTCGCCGACCGTGTATTTGATTTGTTTGACACAAAA
CACAATGGAATTTTAGGATTTGATGAATTTGCTCGTGCACTCTCAGTATTTCATCCAAGT
GCTCCACTTGATGAGAAGATTGACTTTTCATTCCAGTTATATGATCTCAAGCAACAAGGC
TATATTGAGAGACAAGAGGTTAAGCAGATGGTTGTTGCTACACTTGCTGAGTCTGGAATG
AATCTTTCTGATGAAATTATAGAGAGCATAATCGATAAGACATTTGAGGAGGCAGACACA
AAGCATGATGGAAGAATTGATAAAGAAGAGTGGCGCAATCTGGTTCTTCGTCATCCCTCT
TTGCTGAAGAACATGACTCTCCAGTACCTCAAGGACATCACCACTACATTTCCAAGCTTT
GTCTTCCATTCCCAGGTCGATGACACCTGAATTCTTGGATTTGTTTGAACTCAAACCATC
AGAAGAATGCTCATGCCGGTTCATTAAGAATTTTGATATTGGGTTGTTGGATTGGGCAGA
GACTCCAGAGCTCTGTAGGATGTTGCATGTTCGATTTGAGAAGTTCTCAAATCTTTAAAT
TGATGTAACTTTGTTTCTTTCGTTTGGAAGTTTAGTGTGGCTGGAGACTTTCGGGGAGAT
GTTAAATTTCTGTCTGAATCCGTAGATCCTTTATTCTCTTCCCCTCTTTTCTGTTTTTCT
GGCTAGCAATCAGAATATCTTTTCTGTTTTTTTGGCTAGCAATCAGAATATCGGATATAG
TTTTGTGAATCTTTCATTTTGCGTACAAAATAGGAACCTTCAAAAAAATTGATCGTGCTG
GAAAATGTTCTGTTGGAGTTTGCAAATTGCAATGATCATGAAATGCTCTCCTTTTTTGAG
AGTTTGCA

CDS

678 bp

>Os12t0597000-01 Similar to Calcineurin B-like protein 2 (SOS3-like calcium binding protein 1).
ATGGTGCAGTGTCTCGACGGGGTGAGGCAgctgctggcggtcgtgttcaagtgctgcgac
ctcgagctgaagcagccgcgggggCTCGAGGATCCCCAGGTCCTCGCGAGGGAGACCGTC
TTCAGCGTGAGCGAGGTCGAGGCGCTGTACGAGCTCTTCAAGAAGATAAGCAGTGCTGTG
ATTGATGACGGGCTGATTAACAAGGAGGAGTTTCAGTTGGCGCTGTTCAAGACCAGCAAG
AAGGAGAGCCTGTTCGCCGACCGTGTATTTGATTTGTTTGACACAAAACACAATGGAATT
TTAGGATTTGATGAATTTGCTCGTGCACTCTCAGTATTTCATCCAAGTGCTCCACTTGAT
GAGAAGATTGACTTTTCATTCCAGTTATATGATCTCAAGCAACAAGGCTATATTGAGAGA
CAAGAGGTTAAGCAGATGGTTGTTGCTACACTTGCTGAGTCTGGAATGAATCTTTCTGAT
GAAATTATAGAGAGCATAATCGATAAGACATTTGAGGAGGCAGACACAAAGCATGATGGA
AGAATTGATAAAGAAGAGTGGCGCAATCTGGTTCTTCGTCATCCCTCTTTGCTGAAGAAC
ATGACTCTCCAGTACCTCAAGGACATCACCACTACATTTCCAAGCTTTGTCTTCCATTCC
CAGGTCGATGACACCTGA

Protein

226 aa

>Os12t0597000-01 Similar to Calcineurin B-like protein 2 (SOS3-like calcium binding protein 1).
MVQCLDGVRQLLAVVFKCCDLELKQPRGLEDPQVLARETVFSVSEVEALYELFKKISSAV
IDDGLINKEEFQLALFKTSKKESLFADRVFDLFDTKHNGILGFDEFARALSVFHPSAPLD
EKIDFSFQLYDLKQQGYIERQEVKQMVVATLAESGMNLSDEIIESIIDKTFEEADTKHDG
RIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT*

5'UTR

chr12:25063210..25063411 (+ strand) : 202 bp

chr12:25063526..25063695 (+ strand) : 170 bp

CDS

chr12:25063696..25063816 (+ strand) : 121 bp

chr12:25063948..25064030 (+ strand) : 83 bp

chr12:25064168..25064227 (+ strand) : 60 bp

chr12:25065302..25065410 (+ strand) : 109 bp

chr12:25065626..25065678 (+ strand) : 53 bp

chr12:25066172..25066252 (+ strand) : 81 bp

chr12:25066860..25066972 (+ strand) : 113 bp

chr12:25067693..25067750 (+ strand) : 58 bp

3'UTR

chr12:25067751..25068208 (+ strand) : 458 bp

FASTA

>Os12t0597000-01 class=Sequence position=chr12:25063210..25068208 (+ strand)
AGACGCACGC GCACACGCAT ACGCATCGCA GCCAGTTCAT CCTCGATTCC TCCCCCGAAT TTCCTTCGCG ATCTCACCCC
GCGTGCCCTA GCTAGCTATC GAATCCCGTC ACCTCGGCGG CGGCGGCGAG ATCGGAGCTC CGGGTTAACC TCCTCCACCG
CGAGGCGTGG AACCTCTCTC TCTCTCGCTC TCTCCACCTG AGGTGCGCGT GGCCCAGCTC TGTGATCCGA TTCGATCGGT
CGAGTTGGAG GGAGGGCTAC TCTATTCTGC GATGGCGATT GATTGATTGA TTGATCTGGT TGGGGCTTGG TTGCAGGATC
GAAGATCGAA ACCCCTGGCA CCGGCTCGGG CCGCGGAATG GGCGGCCGCG GTGAGTAGCT AGGTCTGCGG CGGCGGAGTT
GTTGTTGTTG GTGGTGGTGG TGGTGGAGGA GGAGTTGGCG GCGGAGGGGG CGGGGGCGTT GGTGGTGGTG GTGGTGGGAG
AGTATCATGG TGCAGTGTCT CGACGGGGTG AGGCAgctgc tggcggtcgt gttcaagtgc tgcgacctcg agctgaagca
gccgcggggg CTCGAGGATC CCCAGGTCCT CGCGAGGGAG ACCGTCTGTA AGTCCGCCGC ATTCGCCATT GGTTGGGGCG
CCGTACTCCT CCTTCCTTTT GTTGCTGAGC CTGTCTCATT GGGGGAATTT GACTGGTGTG TGTGGTTGGG TTGGATTTTG
TGGCCTTGTG TTGTGCAGTC AGCGTGAGCG AGGTCGAGGC GCTGTACGAG CTCTTCAAGA AGATAAGCAG TGCTGTGATT
GATGACGGGC TGATTAACAA GGTTGGTGTG GAGTCCTCTG TTCGCGCCAC GATTTTGTAT CGTAGAATTG GGATTGATTG
ATTGGTTGAT TGATGAAGGC ATGTTATTGT GAACCTGTAT GCAATCACTG ACTGTGTTTG TCCGTTGACC TTGTGCAGGA
GGAGTTTCAG TTGGCGCTGT TCAAGACCAG CAAGAAGGAG AGCCTGTTCG CCGACCGTGT AAGTCTGCAT TGATTGCAAA
CTTGTTAATT ATTGTATGGT GCTGCATGCC GTTGCTCTGA TTCGGTATAT CGCGCTCTTC TCTTTTGGAA GTTTTGAAAA
GCGACAGATT TAGGCGCGCC TAGTCAATGA AGCATGAGCA ATTGAACACT AGAGACTATT TGACTATACT GGACAAAATT
GAATGCTTCT AATTGCATGG AAATAGTATT AGTTATCTAG GATTATATTG GTCTAAGTTT CGGATATGCT ATATACCGCA
TATGCTTTAA TTTAGGATTT TTCCTTTCCT GTATTGTTTC CTGCCAAACA TGTCTCCAAA TAACATCTGA CCGTTGGTTA
GTCATTTCCC TGCCATGGCT TGTCTTCCGC CCTATGGCCT GCACCATTTC ATTATTTCCC GCTCTAATTT GGCCTTGTCC
AGAATTCTCT AGGCTTTTCC GACATCTTAT CTAGTACCTT TTTTAATGTT AATCCTCATG CATGTTTGTT TGTAACCAAA
TCATTAATTA CTTTATACGT GAAATTTCTT GAACTGTTAT GCTATAGCAT CAGTATTACA TTTTACATCT CGTGTGTACT
TGATTCGTCT GTATCAGTTA CAAGTTTCCT TAATCACAAT GTTCATGTTT CGCAGATGGA GTGCTGTATT ATGCATAATT
GGGACTTTGC ACATGTTTTA AGTGTTTTGG CTATTATGTT ATTATGCTAT CATTATGAGT GTCTTTTACC TTTTGCATTG
CATCTAGCAC ACTTCTGTAT TTGAGTTCTG ATTTGTGAGC TTTGATCCGT TTGTTATCCA AATTTGAGTA GTACCTTTCA
TTGGCCATTC GTACTATAAG CGAATGCCTT ATCGTGTAAA TATATTTTTG TAGTTAAATT CCATTGAAAT CAATTGGTAT
TGTTGTATGG CTAATACTGT CCATCACAAC TGTTGTCTTG TTACATTTAT CAGTTGAAGC TACATGTGAC CAAATTCTTT
GTAGAAAAAT AGCTGTATGA TAGATGTCAG TGCAGATTTT GCCTTTATCT CCGTGCTGCC TCATGTTCTT AATATTCTCC
CTGCTCTTAC AGGTATTTGA TTTGTTTGAC ACAAAACACA ATGGAATTTT AGGATTTGAT GAATTTGCTC GTGCACTCTC
AGTATTTCAT CCAAGTGCTC CACTTGATGA GAAGATTGAC TGTGAGTTCA GACGTACTGT AGCTAGATAT TTTACTCCTC
ATCTATGCAG TTCTAAATTA TGTATTGTCA CAATAATGGC TTGGAGCTTA TTTGCAAAAG TATTTATTGT AGACTTAAAG
TTGATAGTCT GACTTCTATG CTGTCCTCCA GGTTTTCTCT TGTTTACTTA TCTTTTCTCA ACAAAAAATT CTGAAGAAGC
TATGCAATTT TTGCAGTTTC ATTCCAGTTA TATGATCTCA AGCAACAAGG CTATATTGAG AGACAAGAGG TATTGATGCC
AAATTACTCA TTGCACAGTG CTCCTTCAAG CTAGCATGTT GGCTTGTCTA TATGGCTCAC ACACTTCGAT TAATTCAACA
TTTTCTTTTA TTGTTTCTGA TACATGAAAT CGTGGTTTTA TTCATGTAAC TATTCTGTAC TTGATGGTCT ATATTTGTTG
TTTTGTTATG GCATACTGCA GAAAGAAATG TCATTTTTTC ATTAATACTG TCAGATCACT GTCGTTGAAT TTTACAAGAT
TTTAAATCAC GTAGTAGCAG CAATAGCTTA ATCATGTTGC GTTTAGGTGA GTTAGGTTTT GATTCCAATG AATTGCACTG
GGCTTTGTTG CTGAGAGATG ATGACTATAT CTGCCAATCT TTAAATAGCT GATATGCCAT TATCAAAGCT AAATATTTTA
AATAGTTTTG TTGTGGATGT CATTCTTTTG GGTAGGATAT TTCCTTTTAC TTCATCTATA GTTTATAAAA TTGATTTATC
AGGTTAAGCA GATGGTTGTT GCTACACTTG CTGAGTCTGG AATGAATCTT TCTGATGAAA TTATAGAGAG CATAATCGAT
AAGGTATGTT ACGGTTTCCA TTTATATTTT GTTGTGTTTG GTTATACCCT GTATTGGATG GTATTTTTTT AGTTGGTATT
TTGTGGTAAT CAGTAATTCT CAGCCTGCTT ATATAGGTCA GACTTTTGTA TAGCCTAGCC TTATCATACT ACATATATAC
TGTATTTACT TTGCAAATGA AAAACTGCAT CGGTATGTTT CCTTATTATA TAAGATGTTG GTAAAAAAAA CATTGAACTT
CTTGGTGAAA CATAGTAAGA AATGTGCCAA TTTGTAACAA TAAGATGACA CGTACTAAAA GAACTATAAA TGTGTAATAT
TATCATAGTA TTTTATGTAT AAATTTACTC TTCATTTTCA TCCAAATTAT ATATTAATAT ATTATAGACA ATAATGTTCG
CACAAATTAT TGTGGTTTAA TTAGATGTGT TCTGGATGGC ACTATTTTTA AACTGATAGA AGTAATACTG ATTTTGTGCT
ATTACTTTTT TTTAATAGAT AGATATTTAG ATGACATATC CTCAATAGGC TTGGCATAAG ATATGGTCAG TTTATCTTGT
TTCTTTTTAA TTGTAACTTC CAATGCTAAA CTATTTTTTC TTATTTGTAG ACATTTGAGG AGGCAGACAC AAAGCATGAT
GGAAGAATTG ATAAAGAAGA GTGGCGCAAT CTGGTTCTTC GTCATCCCTC TTTGCTGAAG AACATGACTC TCCAGTACCT
CAAGTAAGAT ATGTTTTTTT TTTGTTTATA CTCTGTATAT TTTTAATAGC TTGGCTCTTT TTGTTCCTGT CTTTTATTTA
CATCTGGGCA CAATTCTGAA TTCTCTCAAC TTAATGTTGG ACACCTTAAG TTTTCATCTT GATAGTTGTA ATGGCAATGT
TTACTGCTGT TCTTGAACAA AAATGGTTGG ATTCGGATTC CCATTCCAAA TTTTATTTGC CATTGCAATG TCTTGCAAAG
GAAAGAATGT TACGGAGAGA GATGCATGCT TGAAATGTGT AAATCAAGCA TCCTCTAATT AAAATTGCGC ATGCACATAG
AGTCGCATGG AGGAGTGAGG AGAGCATGTT GTATCATCTC TTGATTTTAA ATAGTAATTG TTTTATCTAA TCCATAATAT
GTAAGAGGAA AAGAACAAGT TCATGATTTT AAATACATGC CTTGTCAACT CACTGCGCAT ATTTTTATTT CTAAAAAAAC
ATGTGTTGAA CTACTGGATG AGTTGGTCGC TCCATGTTTC AGATTCAAGC AATCCACTTC ACAGATACAA CAGCACTTCA
TATATTGACA AAAAATAACA CACTGCCTTT TTTGTTCTTA ACTAAAGAAG TATTTTTTTT CCTAAAAAAG ATTAGGTGTT
CATAAAAATG TTCAAGTCTA TAAAAATGTT GTAGACACTT TTGTTTTTCT ATAGCACAAG CTAATCTTGC CACATGTGTG
CAGGGACATC ACCACTACAT TTCCAAGCTT TGTCTTCCAT TCCCAGGTCG ATGACACCTG AATTCTTGGA TTTGTTTGAA
CTCAAACCAT CAGAAGAATG CTCATGCCGG TTCATTAAGA ATTTTGATAT TGGGTTGTTG GATTGGGCAG AGACTCCAGA
GCTCTGTAGG ATGTTGCATG TTCGATTTGA GAAGTTCTCA AATCTTTAAA TTGATGTAAC TTTGTTTCTT TCGTTTGGAA
GTTTAGTGTG GCTGGAGACT TTCGGGGAGA TGTTAAATTT CTGTCTGAAT CCGTAGATCC TTTATTCTCT TCCCCTCTTT
TCTGTTTTTC TGGCTAGCAA TCAGAATATC TTTTCTGTTT TTTTGGCTAG CAATCAGAAT ATCGGATATA GTTTTGTGAA
TCTTTCATTT TGCGTACAAA ATAGGAACCT TCAAAAAAAT TGATCGTGCT GGAAAATGTT CTGTTGGAGT TTGCAAATTG
CAATGATCAT GAAATGCTCT CCTTTTTTGA GAGTTTGCA

Locus: Os12g0597000

Loading...

Locus: Os12g0597000

Loading...