Os12t0601300-01

Locus

Os12g0601300

Description

Similar to Auxin-responsive protein (Aux/IAA) (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA30

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA30

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 30

Transcript Evidence

AK068213 (DDBJ, Best hit)

Protein Evidence

P0C132 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

J013149K13 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0601300-01)

RiceXPro (AK068213)

Others

Oryzabase (10917)

KEGG (Os12t0601300-01)

Transcript

1544 bp

>Os12t0601300-01 Similar to Auxin-responsive protein (Aux/IAA) (Fragment).
CTCCTTTACATCACATTTCTAGCCACCCTCTCATCATCACCATCAAGCTCAAACCAACAA
GAAGAGAGCTAGCTTTTGGTACTATTAGCCACTAGTAGATAGCCAAGAAGAAACCAAGAA
ATTCTTTGAGCTATCTAATTAGCTAGGTCCATTGATTCATCATCATCTCCATTGATCCAC
TTAGCTTTGAAGAAGAAGAAGAAGAAGACATTTAGTTAGCTAGCTATATTGAGGTGAGGT
GGCGGCGGCAATGGCGGCGGACCTGGCCTTCGAGGCGACCGAGCTCCGGCTCGGCCTGCC
CGGCGGCGGCGGTGATGGAGACGCCGCGGCGGCGGCGGCGAGGAGCTCCTCCGGGAAGAG
GGGCTTCGCCGAGACCATCGACCTCAAGCTGAAGCTGGAGCCGGCGGCCGCGGCGGTGGA
CGACGACGACGACAAGGAGGAGGCGGCGGCTGACGACCGGGAGAAGAAGGTCGACATCGT
CGGAGCTGACAACGACGACGCCTCGCCGCCGGCCGCCGCCGCCGCCGGCGGGATGAAGCG
GTCGCCGAGCCAGAGCAGCGTCGTCACCGCCGCCGCCGACCCCGAGAAGCCAAGGGCTCC
CAAGGCACAGGTGGTTGGGTGGCCGCCGGTCCGGTCATACCGGAAGAACATCCTGGCCGT
GCAGGCCGACAAGGGCAAGGACGCCGCCGACGGCGGCGGCGACAAGTCCGGCGCCGGCGC
CGCCGCCGCCGCCTTCGTGAAGGTGAGCATGGACGGCGCGCCATACCTGCGCAAGGTGGA
CCTCAAGATGTACAAGAGCTACCTTGAGCTCTCCAAGGCACTCGAGAAGATGTTCAGCTC
CttcaccattgGAAACTGTGGGTCTCATGGGGTGAACGGCATGAACGAGAGCAAGATTGC
TGATCTGCTCAACGGCTCTGAATATGTGCCAACCTACGAGGACAAGGACGGCGACTGGAT
GCTCGTCGGCGACGTCCCATGGGAGATGTTTGTTGAATCATGCAAGCGCCTTAGGATAAT
GAAAGGATCAGAAGCTATTGGCCTTGCACCGAGGGCAATGGAGAAATGCAAGAACAGAAG
CTGAGAAAGAAGAACATGTCGCCATCAAAAACGGATGGATCATCATCAGATGCAACAATC
TATCTATAGCTTTTCTTAATTGCAGCTTTGCCTCATCCCTGTATCATACTCGCTTGCTGT
CCTCATCTCCAAGTCTGTACCTTTCCTGATCAGTGAAAGTCATTTTGGTGTTGTGGTCAG
TTTCTGTTCTGTTGCAGTCATTAAGTTCCTAAGTGTGTCATCTTGTCTTATACATAAGAA
AGAAGCCAAGAACATGTACCAGTAGTACCTGTCCCATAATTATGTCTTTTTTGCTCTCCC
TGTTCTTCCCTTTCTCTCTGTTTTTTTTTTACCTTAATGGCACAAAATGTAAAGGCACCC
TGCTCAAAGGGACCTCAATGTATTTTGTCCATGAAAAGGTTGTTTAATTATCTTCATGGT
GTATCCATCAAACAAATAATTATTACTGCAAGGTGTTATGTGTT

CDS

834 bp

>Os12t0601300-01 Similar to Auxin-responsive protein (Aux/IAA) (Fragment).
ATGGCGGCGGACCTGGCCTTCGAGGCGACCGAGCTCCGGCTCGGCCTGCCCGGCGGCGGC
GGTGATGGAGACGCCGCGGCGGCGGCGGCGAGGAGCTCCTCCGGGAAGAGGGGCTTCGCC
GAGACCATCGACCTCAAGCTGAAGCTGGAGCCGGCGGCCGCGGCGGTGGACGACGACGAC
GACAAGGAGGAGGCGGCGGCTGACGACCGGGAGAAGAAGGTCGACATCGTCGGAGCTGAC
AACGACGACGCCTCGCCGCCGGCCGCCGCCGCCGCCGGCGGGATGAAGCGGTCGCCGAGC
CAGAGCAGCGTCGTCACCGCCGCCGCCGACCCCGAGAAGCCAAGGGCTCCCAAGGCACAG
GTGGTTGGGTGGCCGCCGGTCCGGTCATACCGGAAGAACATCCTGGCCGTGCAGGCCGAC
AAGGGCAAGGACGCCGCCGACGGCGGCGGCGACAAGTCCGGCGCCGGCGCCGCCGCCGCC
GCCTTCGTGAAGGTGAGCATGGACGGCGCGCCATACCTGCGCAAGGTGGACCTCAAGATG
TACAAGAGCTACCTTGAGCTCTCCAAGGCACTCGAGAAGATGTTCAGCTCCttcaccatt
gGAAACTGTGGGTCTCATGGGGTGAACGGCATGAACGAGAGCAAGATTGCTGATCTGCTC
AACGGCTCTGAATATGTGCCAACCTACGAGGACAAGGACGGCGACTGGATGCTCGTCGGC
GACGTCCCATGGGAGATGTTTGTTGAATCATGCAAGCGCCTTAGGATAATGAAAGGATCA
GAAGCTATTGGCCTTGCACCGAGGGCAATGGAGAAATGCAAGAACAGAAGCTGA

Protein

278 aa

>Os12t0601300-01 Similar to Auxin-responsive protein (Aux/IAA) (Fragment).
MAADLAFEATELRLGLPGGGGDGDAAAAAARSSSGKRGFAETIDLKLKLEPAAAAVDDDD
DKEEAAADDREKKVDIVGADNDDASPPAAAAAGGMKRSPSQSSVVTAAADPEKPRAPKAQ
VVGWPPVRSYRKNILAVQADKGKDAADGGGDKSGAGAAAAAFVKVSMDGAPYLRKVDLKM
YKSYLELSKALEKMFSSFTIGNCGSHGVNGMNESKIADLLNGSEYVPTYEDKDGDWMLVG
DVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS*

5'UTR

chr12:25315901..25316150 (- strand) : 250 bp

CDS

chr12:25315548..25315900 (- strand) : 353 bp

chr12:25313037..25313284 (- strand) : 248 bp

chr12:25311750..25311882 (- strand) : 133 bp

chr12:25311532..25311593 (- strand) : 62 bp

chr12:25311353..25311390 (- strand) : 38 bp

3'UTR

chr12:25310893..25311352 (- strand) : 460 bp

FASTA

>Os12t0601300-01 class=Sequence position=chr12:25310893..25316150 (- strand)
CTCCTTTACA TCACATTTCT AGCCACCCTC TCATCATCAC CATCAAGCTC AAACCAACAA GAAGAGAGCT AGCTTTTGGT
ACTATTAGCC ACTAGTAGAT AGCCAAGAAG AAACCAAGAA ATTCTTTGAG CTATCTAATT AGCTAGGTCC ATTGATTCAT
CATCATCTCC ATTGATCCAC TTAGCTTTGA AGAAGAAGAA GAAGAAGACA TTTAGTTAGC TAGCTATATT GAGGTGAGGT
GGCGGCGGCA ATGGCGGCGG ACCTGGCCTT CGAGGCGACC GAGCTCCGGC TCGGCCTGCC CGGCGGCGGC GGTGATGGAG
ACGCCGCGGC GGCGGCGGCG AGGAGCTCCT CCGGGAAGAG GGGCTTCGCC GAGACCATCG ACCTCAAGCT GAAGCTGGAG
CCGGCGGCCG CGGCGGTGGA CGACGACGAC GACAAGGAGG AGGCGGCGGC TGACGACCGG GAGAAGAAGG TCGACATCGT
CGGAGCTGAC AACGACGACG CCTCGCCGCC GGCCGCCGCC GCCGCCGGCG GGATGAAGCG GTCGCCGAGC CAGAGCAGCG
TCGTCACCGC CGCCGCCGAC CCCGAGAAGC CAAGGGCTCC CAAGTACGTG CACAGCTACC TTAGCTTAGC TAATGCCCTT
CTTAATTTTG CATGCATGCA AATCATGCAA TAATCTCTCC AAATAAAATC AAGTTCAAAC ATCAAACATA CATGTAATCA
TCCTCTCCAA ATAACAAAAC TTAGCAAATT TTAAACCCTA GCATAACCCA CCTCTAACCT TACATAACAA AAGAACAAGT
AAATCCTTTT CATGCCAAGA TTCGCAGATA TTCATCCTGC AGTTGATTTG CTTTTGGGAT AAAGAAAGCT TTATTGATCT
TAGATAATTA CAACAGCCGA GGCAACTGAT TAATTAGCTA CATAGTTAAG TTAATCAGTT AATTCCTCGA TTTATGTATG
TGTATCACAA TGATGAACAC CAAGGATATC GATCGATCGA TCGATGTGAA CCAAAGCGCA AAAAAATTAG TTAATTGTTT
TTTTTTTGTA AACTGTAATA CTAGTATATG AATATAAACC AAATTGATTG CTACTAGGAG AGAAGAGAAA AGAATTAATT
GGTGTGGTAT GTATGGCTGG ATCTAAGGGA CAGATATATT CATTGGTAGT AGATGCACAG AGAGAAAGAG CAAAGCAAAA
TGTACAAGGT ACTAGAGAAG AAGGCAGAGA GACATGGGCA TGTTACTTGT GGGTCACAGG GGAGACACTG CCTAGTGCCG
ACACGATAAA AGAAATAAAG CCACACATAC TACTAATTCT CTCTCTCTCT TTCTTGCACA GTTCATCTTT TGTCCACATC
ACCATCATTT CCATATCACT AGCCCAACCT ATAGTTCTTG AGATGTTACC ACACATGCAT GCATGATAAA GACGAAATAA
ATTAATATTT GGATACACTA Cggccattcc caacccaatg actaggatgg tgtccatagc attaaataag ctgccaccta
aaataaaaaa tgatatggca agtgaataaa tgaagaaaga taaaaaaacc atgagacatg gtttctacac aatattaaag
acatcatgtg agataagtag cattaaattt aagtacggaa tagtggtgct tgcattggaa gagtagtgtc tagtattagt
ttcttgatga tgtggagctt atagaaacta tgtggaacta atatcttagg ttgggaatgg ccTACTACAT ATGTTGGCCA
TGCTTGTTGC CTTTTAGTTC TTGAGAGTAA ATGTATTTAT ACATGCATGG CCTACCATTT TGGATCTGTC TATATACTCT
ACATGCACGG ATGCACCCTT GTCGAGAGTC TTCTGTTCAT ATTTGGTTTT ATTTTTATTT ACAGAAGGAA AATAATTAAA
GGTAGGTTTG GGTAGCCATT GATGTTGCAG GAGTGTGTGT GTGTGTGTGT ATATGGGGGG TTTTTTTTAT TAGTTGAAGA
TGAATTGGAA ATGTGATGTG AAATGTGGTA AATGTTGGGT GTTGTGTTTA ATTATGTGGA TGAAGAATAG GTTGTGTGTT
AGCTTGGAAG GTACATGCAT GTGTGCCACC ACAAAAGGTT CCTCCTTTTT CCATGATTTG ATGCCCCTCC CAATAGTCTC
ATGGACCAGT TCACCTATAT AATACAAGTT TATATACAAG TAAAAGGAGA ATCTCATATA AAACAGAAAA GGGAAATGTA
ATTTATTCTG CATATGGTGA AAACTGAAAA CAAGTAACCA TGTTCACTAG ACAAGGCCTG AAAGTACCAT ATTGACGGGA
GAAAAAGAAA GAGCCATATA TACTCCATTA TATTGGTCTA TTTGTGGATT AATTGGATTA CACCATGTAC ATTGATTAGA
TATATATACC ACCTCCAGTT TGAAGCACCA TTGACTTTTC TACAAAGTTT TCCTTTAAAA AAAACTCTTT CTCCAAAGTT
TGACCATGCA ACAATATTTA CTTAATTACT TAGTTAAATG AAGTGAAAAG ACTCAAAGAG TACTACTATA TCTGTTACCA
aaagtacttt aagcatactt aatttgtatc tctatcgatt tacataaata tttttagaaa agatcaataa tcaaacgaat
taaaaaaatc aatggtgtca tgcatatatt ttaaaccaga gatattaTAT TACAGAGCTA CTACCACCAT TTACGAGAAA
GCTAGTATTA AACCTTAAGA AATAAATAAA AAACACAAAC AATTCTTCAG TAAGATATTT GGTAATAATA TTATAGAGCT
ACTTCTAGTA ACTAGCTACT CTTAATTATT AATCGGTGAA AAAAATTGGT TAAATCTTCT TCACAGGGCA CAGGTGGTTG
GGTGGCCGCC GGTCCGGTCA TACCGGAAGA ACATCCTGGC CGTGCAGGCC GACAAGGGCA AGGACGCCGC CGACGGCGGC
GGCGACAAGT CCGGCGCCGG CGCCGCCGCC GCCGCCTTCG TGAAGGTGAG CATGGACGGC GCGCCATACC TGCGCAAGGT
GGACCTCAAG ATGTACAAGA GCTACCTTGA GCTCTCCAAG GCACTCGAGA AGATGTTCAG CTCCttcacc attggtaatt
atattaatta cacataatat atgtttttat atataccatc gtattttcat tcattccaca tattcgcatt ttAAATGTCT
ATTCCTTTAA AAATCTCACG CTCAACATAT CTAtcctaaa atataacaat ttttgatagc tatacacata tctggataac
aacttgttca gatacaaagc tataagttat tatattttgg tatagatgta gtaTTTATCA TATAATTTTA CAAAAGCTAT
AATTGAATTA TATTGTTTTG TGCAAAGTTA GTGAGAACTT CCAAGACCTA AATATATAGG ACTTTGATTA GGGTATTGTT
GCCTAGCTTT AATCTTTGTG CAAAGTGAGG TTATAAAGTT AGTAGCAGCT AGCTTAGGTG GTGCATGATG AAGGGTTGGG
GTATATGATT GCATTTGGGG GGGCATTTGC ATGTGTGGTG GTGGTCACCA TGTGGTTTTT GCCAAGGAGT GCACTCCATG
ATTTGATTAA TTTGCATCCT TTGGTAGTAG TAGGTGTGTC TGCCTGCCCT AGTTGTCTGG CATAATGCCA TTGTCTCTCA
TCTCTCTTTG CTAGCTAACA CATGTACATG GATATCATCA TCATATATAT GTTTGCTATC TATAGATGTT AATTTGCTAG
CTAAGCTCAT GATCAAGGTT GCATATATCT GCTTAATTAG CTACTAGCAG CTGGAGTTTG GTCCATTGAT CATTGGCATG
TGCTGCTCTA AATCCAAGTG CATAATAATC AAATCCACGT GTTGATGCAT GCATCTTTAA AAAAGATATG GGAAACATAT
GGTATTGTTC AGAGAGCCAA AAGATGATTA AATTGGTCGG CTTTTTAGGT GTGCAAGTGT GTGTGAGGTT CGTTTACTGA
TTGAGCCTTG ACACTTGCTT TTAATTAGTA GATAGCTAAT TACCTCAATC ATTGTCATAT AGAAGTGCAA TATAATTCTC
CATTCCAAAC TGAACTCTGA ACAAACCTAG CAATGCAAAA AAAAAATACT CTGGAAACTG TTAAATTGCA AAGAAAAATA
GACATCATTT TAATTAGGTT GTACTGTATA ATCAAATTAA TCGGCATGGA GTTGTAGATG CTTAATGTTT TTGGTATGAA
GCTTAATGTC TGAATTAATT TTCATCAGGA AACTGTGGGT CTCATGGGGT GAACGGCATG AACGAGAGCA AGATTGCTGA
TCTGCTCAAC GGCTCTGAAT ATGTGCCAAC CTACGAGGAC AAGGACGGCG ACTGGATGCT CGTCGGCGAC GTCCCATGGG
AGTCAGTAAT CTCTACTTAA ATTTTCTATT ATCTAATATC TAAGTGTTTA ATTTTAATAA CCTGAATTAA GGTACTAGTC
TGAATCTCTG ATATGAGTCC ATGCTCTGCA TCTGTGTTCT GAATTCTGAC CATTTTGTTT GGAAATGGAA ATTTCAGGAT
GTTTGTTGAA TCATGCAAGC GCCTTAGGAT AATGAAAGGA TCAGAAGCTA TTGGCCTTGG TCAGTGCATA TCAAGTTTTA
TTTCTACATA CAAATTAGCT CCTTTGGGTT TGATTTTAAG TTGGGGTTTA ATTTAAGTTG GATATCAGTT ACTGACAGAA
CAGTGAAATA TAATATATTT TTTGTTTTGA ATTGTTTCAG CACCGAGGGC AATGGAGAAA TGCAAGAACA GAAGCTGAGA
AAGAAGAACA TGTCGCCATC AAAAACGGAT GGATCATCAT CAGATGCAAC AATCTATCTA TAGCTTTTCT TAATTGCAGC
TTTGCCTCAT CCCTGTATCA TACTCGCTTG CTGTCCTCAT CTCCAAGTCT GTACCTTTCC TGATCAGTGA AAGTCATTTT
GGTGTTGTGG TCAGTTTCTG TTCTGTTGCA GTCATTAAGT TCCTAAGTGT GTCATCTTGT CTTATACATA AGAAAGAAGC
CAAGAACATG TACCAGTAGT ACCTGTCCCA TAATTATGTC TTTTTTGCTC TCCCTGTTCT TCCCTTTCTC TCTGTTTTTT
TTTTACCTTA ATGGCACAAA ATGTAAAGGC ACCCTGCTCA AAGGGACCTC AATGTATTTT GTCCATGAAA AGGTTGTTTA
ATTATCTTCA TGGTGTATCC ATCAAACAAA TAATTATTAC TGCAAGGTGT TATGTGTT

Locus: Os12g0601300

Loading...

Locus: Os12g0601300

Loading...