Os12t0601400-01

Locus

Os12g0601400

Description

Similar to Auxin-responsive protein (Aux/IAA) (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA31

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA3, OsIAA31

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 3, Aux/IAA protein 31

Transcript Evidence

AK073361 (DDBJ, Best hit)

Protein Evidence

P0C133 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

J033027E22 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0601400-01)

RiceXPro (AK073361)

Others

Oryzabase (10523)

KEGG (Os12t0601400-01)

Transcript

1163 bp

>Os12t0601400-01 Similar to Auxin-responsive protein (Aux/IAA) (Fragment).
ACGAAGACAAAGTCAGAGGTCACACAGCTCATCGTCTCGAGCTACCTAGCTGGAAGAAGA
AGAGGAAGAAGAGGAGGAGGAGCTCGTCGGAGTTTAGTTGGTGAGTTCGCCGGAGAGATC
GATCATGGAGAATCTGAAGGCGACGGAGCTGAGGCTCGGGCTGCCGGGGACGGAGGAGGA
GGCGGCGCCGCCGCCGTCGACGCCCAGGGCCGGAAGCAAGCGCGCCCTCGCCGGCGAGCC
TGATCAGGCCAAGATCAAGCCCGCCGCCGCCGCCAAGGCGCAGGTGGTGGGATGGCCGCC
GGTGAGGTCGTACAGGAAGAGCTGCCTCCAGCCGACGACGACGACGACGAAGAGCAAGCC
GCCGCCGGCTGCCGCGGCGGCGGAGACGCAGCAGAAGGAGGATGTCGCCGGCGCCGGTGG
GCTGTTCGTGAAGGTGAGCATGGACGGAGCTCCATACCTGAGGAAGATAGACCTCAAGGT
GTACAAGGGCTACCGGGAGCTTCGCGAGGCACTGGAGGCCATGTTCCTCTGCTTCTCCGG
CGGCGCCGCCGCCGACGCCGCCGTCAACCCGTCCGACTTCGCCGTCACCTACGAGGACAA
GGACGGCGACCTCATGCTCGTCGGCGACGTCCCATTCGAGATGTTCATTAGTACGTGCAA
GAGGTTGAGGATCATGAAGGGGTCTGAAGCAAGAGGCCTAGGAGCAACAAGGGGTTAAAA
ACTGAACAACAACAAGAAGAAATCATCATCATGTGTGCATGAGCAATTCTTTTGTTCTTT
TTGGGTTCTCCAAGACATGCAATCATCTCATCTCCTCATTGCAACCTTCAAGAAAGAGAG
AGAGAGAAAGAAAAGGAAAGCAAAAAAAAAAAAGATGCAGTGAAAAAAATATGTGAAGCT
TAATTGGAGTCATCAGATTGCAAAGCATGCATGCATGTGTGGATGTGTGGCTTTAATTTG
TTTTTTTCCTCTTAATTAGGTGTTAGAAAACACAGAAGGAATGGAGGTTCGAGTTGAGCC
TCCATGTGTGTTTGTACAAAGCAAACATCTTTTTTCTTTTACATGAATGGTTGATTACTT
TTGTAACTGGAGGGAAGAAGAATGCATGTATGCATGGGCTGTGTGTACTTCTCCCTCTGG
CTTCAATGCTTTGATTTCCATCC

CDS

594 bp

>Os12t0601400-01 Similar to Auxin-responsive protein (Aux/IAA) (Fragment).
ATGGAGAATCTGAAGGCGACGGAGCTGAGGCTCGGGCTGCCGGGGACGGAGGAGGAGGCG
GCGCCGCCGCCGTCGACGCCCAGGGCCGGAAGCAAGCGCGCCCTCGCCGGCGAGCCTGAT
CAGGCCAAGATCAAGCCCGCCGCCGCCGCCAAGGCGCAGGTGGTGGGATGGCCGCCGGTG
AGGTCGTACAGGAAGAGCTGCCTCCAGCCGACGACGACGACGACGAAGAGCAAGCCGCCG
CCGGCTGCCGCGGCGGCGGAGACGCAGCAGAAGGAGGATGTCGCCGGCGCCGGTGGGCTG
TTCGTGAAGGTGAGCATGGACGGAGCTCCATACCTGAGGAAGATAGACCTCAAGGTGTAC
AAGGGCTACCGGGAGCTTCGCGAGGCACTGGAGGCCATGTTCCTCTGCTTCTCCGGCGGC
GCCGCCGCCGACGCCGCCGTCAACCCGTCCGACTTCGCCGTCACCTACGAGGACAAGGAC
GGCGACCTCATGCTCGTCGGCGACGTCCCATTCGAGATGTTCATTAGTACGTGCAAGAGG
TTGAGGATCATGAAGGGGTCTGAAGCAAGAGGCCTAGGAGCAACAAGGGGTTAA

Protein

198 aa

>Os12t0601400-01 Similar to Auxin-responsive protein (Aux/IAA) (Fragment).
MENLKATELRLGLPGTEEEAAPPPSTPRAGSKRALAGEPDQAKIKPAAAAKAQVVGWPPV
RSYRKSCLQPTTTTTKSKPPPAAAAAETQQKEDVAGAGGLFVKVSMDGAPYLRKIDLKVY
KGYRELREALEAMFLCFSGGAAADAAVNPSDFAVTYEDKDGDLMLVGDVPFEMFISTCKR
LRIMKGSEARGLGATRG*

5'UTR

chr12:25325555..25325678 (+ strand) : 124 bp

CDS

chr12:25325679..25325830 (+ strand) : 152 bp

chr12:25325929..25326291 (+ strand) : 363 bp

chr12:25326588..25326666 (+ strand) : 79 bp

3'UTR

chr12:25326667..25327111 (+ strand) : 445 bp

FASTA

>Os12t0601400-01 class=Sequence position=chr12:25325555..25327111 (+ strand)
ACGAAGACAA AGTCAGAGGT CACACAGCTC ATCGTCTCGA GCTACCTAGC TGGAAGAAGA AGAGGAAGAA GAGGAGGAGG
AGCTCGTCGG AGTTTAGTTG GTGAGTTCGC CGGAGAGATC GATCATGGAG AATCTGAAGG CGACGGAGCT GAGGCTCGGG
CTGCCGGGGA CGGAGGAGGA GGCGGCGCCG CCGCCGTCGA CGCCCAGGGC CGGAAGCAAG CGCGCCCTCG CCGGCGAGCC
TGATCAGGCC AAGATCAAGC CCGCCGCCGC CGCCAAGTAA TTAATATCAA GTTCTTCTTC GTCTTCGTCG CCGTCGCCGC
CATGGATGGC AGAGCTAGCT CTGATACGTG TCGTGTTTGC TGCTGCTGCT GCAGGGCGCA GGTGGTGGGA TGGCCGCCGG
TGAGGTCGTA CAGGAAGAGC TGCCTCCAGC CGACGACGAC GACGACGAAG AGCAAGCCGC CGCCGGCTGC CGCGGCGGCG
GAGACGCAGC AGAAGGAGGA TGTCGCCGGC GCCGGTGGGC TGTTCGTGAA GGTGAGCATG GACGGAGCTC CATACCTGAG
GAAGATAGAC CTCAAGGTGT ACAAGGGCTA CCGGGAGCTT CGCGAGGCAC TGGAGGCCAT GTTCCTCTGC TTCTCCGGCG
GCGCCGCCGC CGACGCCGCC GTCAACCCGT CCGACTTCGC CGTCACCTAC GAGGACAAGG ACGGCGACCT CATGCTCGTC
GGCGACGTCC CATTCGAGTA AGTTGCTTCC AAtttttttt agtttaatta agtttaataa atttttttta caacttctag
tatcataaat tagtatcatt aaatctaaca ttaatatatt ttgatagtat atatgtttgt ctttttaaat gctactatgt
ttttctataa atttgggtta aacttaaaat ttgcctaaaa taaaatcaga acagcttata atatgaaTCA GAGAAAATTG
GAACGACTTA TAGTATGAGT CAATTATTTA CTTGAATTAT TTCTAATTAA CTCTATGATT GTCTTTTTAA TAGGATGTTC
ATTAGTACGT GCAAGAGGTT GAGGATCATG AAGGGGTCTG AAGCAAGAGG CCTAGGAGCA ACAAGGGGTT AAAAACTGAA
CAACAACAAG AAGAAATCAT CATCATGTGT GCATGAGCAA TTCTTTTGTT CTTTTTGGGT TCTCCAAGAC ATGCAATCAT
CTCATCTCCT CATTGCAACC TTCAAGAAAG AGAGAGAGAG AAAGAAAAGG AAAGCAAAAA AAAAAAAGAT GCAGTGAAAA
AAATATGTGA AGCTTAATTG GAGTCATCAG ATTGCAAAGC ATGCATGCAT GTGTGGATGT GTGGCTTTAA TTTGTTTTTT
TCCTCTTAAT TAGGTGTTAG AAAACACAGA AGGAATGGAG GTTCGAGTTG AGCCTCCATG TGTGTTTGTA CAAAGCAAAC
ATCTTTTTTC TTTTACATGA ATGGTTGATT ACTTTTGTAA CTGGAGGGAA GAAGAATGCA TGTATGCATG GGCTGTGTGT
ACTTCTCCCT CTGGCTTCAA TGCTTTGATT TCCATCC

Locus: Os12g0601400

Loading...

Locus: Os12g0601400

Loading...