Os12t0604700-01

Locus

Os12g0604700

Description

Similar to LSTK-1-like kinase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsNek2

Oryzabase Gene Name Synonym(s)

NIMA-related kinase 2

Transcript Evidence

AK072382 (DDBJ, Best hit)

Protein Evidence

Q2QMH1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

J023075D08 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0604700-01)

RiceXPro (AK072382)

Others

Oryzabase (9926)

KEGG (Os12t0604700-01 (EC:2.7.11.1))

Transcript

2373 bp

>Os12t0604700-01 Similar to LSTK-1-like kinase.
GAACCCCACCAAAAACCCCATCTTTTTTTTCTTTTCTTTTCATTTTCGTTCTTCCCTCGC
TGCGGCTTTCAATTTCGCGGCTCGTGTTCTTCTCTTCTCGGTGCCCCTGCCTTGGCTCTC
CTCCGATCAAATGCGGCGAGATCTGCGCGCGTGAAGGCGTCGGCGCGGGGGCCCAAAGAT
CGATCCTTTGCTGATCGGGAGTTTGGGTGGGGGGAAGCGAGTTCTTGGATCTTCGCGGTG
GTTTCTTGGGGGCGTCTCTCGTAGGAAAAAGGGATGGATCAGTATGAGGTGCTGGAGCAG
ATTGGGAAAGGGGCGTTTGGCTCGGCGTTGTTGGTGAGGCACAAGCTGGAGAAGAAGAAG
TATGTGCTGAAGAAGATTCGGCTTGCGCGGCAGACCGACCGCACCCGCCGCTCTGCGCAC
CAGGAGATGCAACTTATTGCGACGGTCAGGAATCCGTTTATCGTGGAGTACAAAGATTCA
TGGGTGGAGAAGGGTTGCTATGTCTGCATTGTTATAGGATATTGTGAGGGAGGAGACATG
GCTGAAGCTATTAAAAGAGCTAATGGTACATATTTCTCTGAGGAGAAGCTTTGCAAATGG
CTTGTGCAACTTCTCATGGCTCTAGATTATTTACATGCAAACCACATTCTTCACCGAGAT
GTCAAGTGCTCCAATATTTTCATTGCCAGGGACCAAAGTATAAGACTTGGTGACTTTGGG
CTTGCAAAAATATTGACTTCTGATGATCTGGCATCTTCTGTAGTAGGAACACCAAGTTAC
ATGTGTCCAGAACTTCTTGCTGATATACCATATGGTACCAAGTCAGATATTTGGTCTCTA
GGATGTTGTATATATGAAATGACCGCGCTCAGGCCTGCATTTAAAGCTTTTGACATGCAA
GCGCTGATTAACAAGATCACGAAATCAATAGTCTCACCATTACCCACTAAATATTCTGGT
GCCTTTAGGGGACTTATTAAGAGCATGCTGCGGAAAAGTCCAGAGCACAGACCTAGTGCT
GCACAGCTACTCAAGCATCCACAACTTCAGCCTTATGTGCTGCAAGTCCAATTGAAATCT
AGTCCTACTCGCAACATACTTCCAATCCATCAATCTTTGACTGACAAAGTTAAGAAGATG
ACATTTCCTAGTGACGTGGTTGATTCTGCACGCAGAAGAATGGCCAGGAGGAACTCTCTG
GGAAATGAGAGGACTGTGACATTTAGCAAGCCATCTCCGGAACGGAATTCAGTTAGCTCT
ACACGGAGCATCAAAGAATACACAACCACCCAGAGTGTCAAAGGGCTCTCTGTTGACAGT
AGTGAGGCTGGGGATGAGGTTACCAGTAAAGCCATCATAACAAAGACATCAAGCATCCTA
AGGACGCCCAAGAGCTTGCCAGCCAAGACTTATACAGCTAGAAATCAGCTTGAACCTCCC
AAAACATCGTATAACAGAACATACCGCTCTGAGCTGCCCTCAAAAACAACTCCAAACAAA
ATTGCCCGACCAGCAAGAAGAGCATCACTCCCGCTGTCAACATATGAAACACCCACCAAG
CGCAGCATCAGCATTCTGGAACAACTAGACTCCCCTGACGTCTCTGTGAATGCCCCTCGA
ATCGACAGAATTGCGGAATTCCCACTGGCATCGTCTGAGGACCCCTTGCTCCCCATCCAC
AACAAGCTCTCTCCTGGCCATGGCTCATGTTCCACTCCTCCCTTTATCAACCGGTCAATC
ACCAAGGACAAATGCACGATCCAGGTGTTACGCACCGATGGGGACAACGGGAGCGACTCC
TCAGGCCGCAACGCCACTGCTGCCTCGAGCCGCGGATCCAATGACTCCAGGCAGCAGCGG
TTCGACACCTCGTCGTTCCAGCAGCGTGCCGAGGCATTGGAAGGGCTGCTGGAGTTCAGC
GCGCAGCTGCTGCAGCAGGAGAGGTATGAGGAGCTGGGCATTCTGCTGAAGCCATTCGGA
CCGGAGAAAGCGTCTCCCAGGGAGACGGCCATCTGGCTCACAAAGAGCTTCAAGGAGACG
GCATCATAGCGCCACCTTGTATCAGGCGCGTCTAAAATCGCCAGTTTTGTCATGTGCAAT
ATTAGCTCAGGTAGTGGTAAACAATATTTAGGATTTGAGACTTTTAGCTGTTGGGAGGCA
GCACCATCTCAGTGTTGCTGTTAACTCAAAATCTACTTCTAGCTCTAGCTAGTTTCCAGT
TTTTTACTTTCTATTAGGAATCAGCAATCAGCAGCAGGAGTTGTAGTAGTAGAACTGTAA
GTTAAGCTGAAGATCTTGCAAGATCTTAGAACCTTTGTAATCATGTGGCACCTGCAATCA
TGTAGTGATATAAATGTGGGGTTAAGGATATCC

CDS

1776 bp

>Os12t0604700-01 Similar to LSTK-1-like kinase.
ATGGATCAGTATGAGGTGCTGGAGCAGATTGGGAAAGGGGCGTTTGGCTCGGCGTTGTTG
GTGAGGCACAAGCTGGAGAAGAAGAAGTATGTGCTGAAGAAGATTCGGCTTGCGCGGCAG
ACCGACCGCACCCGCCGCTCTGCGCACCAGGAGATGCAACTTATTGCGACGGTCAGGAAT
CCGTTTATCGTGGAGTACAAAGATTCATGGGTGGAGAAGGGTTGCTATGTCTGCATTGTT
ATAGGATATTGTGAGGGAGGAGACATGGCTGAAGCTATTAAAAGAGCTAATGGTACATAT
TTCTCTGAGGAGAAGCTTTGCAAATGGCTTGTGCAACTTCTCATGGCTCTAGATTATTTA
CATGCAAACCACATTCTTCACCGAGATGTCAAGTGCTCCAATATTTTCATTGCCAGGGAC
CAAAGTATAAGACTTGGTGACTTTGGGCTTGCAAAAATATTGACTTCTGATGATCTGGCA
TCTTCTGTAGTAGGAACACCAAGTTACATGTGTCCAGAACTTCTTGCTGATATACCATAT
GGTACCAAGTCAGATATTTGGTCTCTAGGATGTTGTATATATGAAATGACCGCGCTCAGG
CCTGCATTTAAAGCTTTTGACATGCAAGCGCTGATTAACAAGATCACGAAATCAATAGTC
TCACCATTACCCACTAAATATTCTGGTGCCTTTAGGGGACTTATTAAGAGCATGCTGCGG
AAAAGTCCAGAGCACAGACCTAGTGCTGCACAGCTACTCAAGCATCCACAACTTCAGCCT
TATGTGCTGCAAGTCCAATTGAAATCTAGTCCTACTCGCAACATACTTCCAATCCATCAA
TCTTTGACTGACAAAGTTAAGAAGATGACATTTCCTAGTGACGTGGTTGATTCTGCACGC
AGAAGAATGGCCAGGAGGAACTCTCTGGGAAATGAGAGGACTGTGACATTTAGCAAGCCA
TCTCCGGAACGGAATTCAGTTAGCTCTACACGGAGCATCAAAGAATACACAACCACCCAG
AGTGTCAAAGGGCTCTCTGTTGACAGTAGTGAGGCTGGGGATGAGGTTACCAGTAAAGCC
ATCATAACAAAGACATCAAGCATCCTAAGGACGCCCAAGAGCTTGCCAGCCAAGACTTAT
ACAGCTAGAAATCAGCTTGAACCTCCCAAAACATCGTATAACAGAACATACCGCTCTGAG
CTGCCCTCAAAAACAACTCCAAACAAAATTGCCCGACCAGCAAGAAGAGCATCACTCCCG
CTGTCAACATATGAAACACCCACCAAGCGCAGCATCAGCATTCTGGAACAACTAGACTCC
CCTGACGTCTCTGTGAATGCCCCTCGAATCGACAGAATTGCGGAATTCCCACTGGCATCG
TCTGAGGACCCCTTGCTCCCCATCCACAACAAGCTCTCTCCTGGCCATGGCTCATGTTCC
ACTCCTCCCTTTATCAACCGGTCAATCACCAAGGACAAATGCACGATCCAGGTGTTACGC
ACCGATGGGGACAACGGGAGCGACTCCTCAGGCCGCAACGCCACTGCTGCCTCGAGCCGC
GGATCCAATGACTCCAGGCAGCAGCGGTTCGACACCTCGTCGTTCCAGCAGCGTGCCGAG
GCATTGGAAGGGCTGCTGGAGTTCAGCGCGCAGCTGCTGCAGCAGGAGAGGTATGAGGAG
CTGGGCATTCTGCTGAAGCCATTCGGACCGGAGAAAGCGTCTCCCAGGGAGACGGCCATC
TGGCTCACAAAGAGCTTCAAGGAGACGGCATCATAG

Protein

592 aa

>Os12t0604700-01 Similar to LSTK-1-like kinase.
MDQYEVLEQIGKGAFGSALLVRHKLEKKKYVLKKIRLARQTDRTRRSAHQEMQLIATVRN
PFIVEYKDSWVEKGCYVCIVIGYCEGGDMAEAIKRANGTYFSEEKLCKWLVQLLMALDYL
HANHILHRDVKCSNIFIARDQSIRLGDFGLAKILTSDDLASSVVGTPSYMCPELLADIPY
GTKSDIWSLGCCIYEMTALRPAFKAFDMQALINKITKSIVSPLPTKYSGAFRGLIKSMLR
KSPEHRPSAAQLLKHPQLQPYVLQVQLKSSPTRNILPIHQSLTDKVKKMTFPSDVVDSAR
RRMARRNSLGNERTVTFSKPSPERNSVSSTRSIKEYTTTQSVKGLSVDSSEAGDEVTSKA
IITKTSSILRTPKSLPAKTYTARNQLEPPKTSYNRTYRSELPSKTTPNKIARPARRASLP
LSTYETPTKRSISILEQLDSPDVSVNAPRIDRIAEFPLASSEDPLLPIHNKLSPGHGSCS
TPPFINRSITKDKCTIQVLRTDGDNGSDSSGRNATAASSRGSNDSRQQRFDTSSFQQRAE
ALEGLLEFSAQLLQQERYEELGILLKPFGPEKASPRETAIWLTKSFKETAS*

5'UTR

chr12:25522013..25522285 (- strand) : 273 bp

CDS

chr12:25521927..25522012 (- strand) : 86 bp

chr12:25521733..25521799 (- strand) : 67 bp

chr12:25521397..25521462 (- strand) : 66 bp

chr12:25521259..25521305 (- strand) : 47 bp

chr12:25521122..25521167 (- strand) : 46 bp

chr12:25520943..25521023 (- strand) : 81 bp

chr12:25520804..25520846 (- strand) : 43 bp

chr12:25520664..25520713 (- strand) : 50 bp

chr12:25520505..25520586 (- strand) : 82 bp

chr12:25520367..25520416 (- strand) : 50 bp

chr12:25520157..25520230 (- strand) : 74 bp

chr12:25520007..25520058 (- strand) : 52 bp

chr12:25519449..25519904 (- strand) : 456 bp

chr12:25518556..25519131 (- strand) : 576 bp

3'UTR

chr12:25518232..25518555 (- strand) : 324 bp

FASTA

>Os12t0604700-01 class=Sequence position=chr12:25518232..25522285 (- strand)
GAACCCCACC AAAAACCCCA TCTTTTTTTT CTTTTCTTTT CATTTTCGTT CTTCCCTCGC TGCGGCTTTC AATTTCGCGG
CTCGTGTTCT TCTCTTCTCG GTGCCCCTGC CTTGGCTCTC CTCCGATCAA ATGCGGCGAG ATCTGCGCGC GTGAAGGCGT
CGGCGCGGGG GCCCAAAGAT CGATCCTTTG CTGATCGGGA GTTTGGGTGG GGGGAAGCGA GTTCTTGGAT CTTCGCGGTG
GTTTCTTGGG GGCGTCTCTC GTAGGAAAAA GGGATGGATC AGTATGAGGT GCTGGAGCAG ATTGGGAAAG GGGCGTTTGG
CTCGGCGTTG TTGGTGAGGC ACAAGCTGGA GAAGAAGAAG TGAGCTTTTG ACTCGACATT GTTCATCTCA TTTTTCTTTC
TTTCCTTTTT TTTTTGGCAT TCTTGAAGCT CACTGTTATT TCAGCCATTT TGATCATGTT GGAGGTTTGT GTGTGTGTTT
ATGCAGGTAT GTGCTGAAGA AGATTCGGCT TGCGCGGCAG ACCGACCGCA CCCGCCGCTC TGCGCACCAG GAGGTAAAAG
CATCATCATC TCTGCATGAG CTGCATTTTT CAGCTTCTGG TACCTAGTAA GCTATGGTTT CAAGGGGAAT GCCTTGTGTT
CACCATGAGC TGCATAAATT GGTGTGTTGG GTGGTGGTGA TGATGATGAT GCTAGTGTGT TTAGTTTGGC TGGTGCTGAA
CTGATCTGAA ACTGTGAAGT TAAAATGATG TGATGTCTTC TTGCTCTTGT GCGGTACTTC CTTTTTTTTT ATACTGATTT
ATGTGGAAAT GCTCCTCATG CAGATGCAAC TTATTGCGAC GGTCAGGAAT CCGTTTATCG TGGAGTACAA AGATTCATGG
GTGGAGAAGG TAGGTGAAAA GGACTGAAGA GAAGGTTATG AAGTTGGGAG GGTGGAATAG ATTTGTTTCA TTCTCACTTC
TTTATCTTTG GATTTTTCAG GGTTGCTATG TCTGCATTGT TATAGGATAT TGTGAGGGAG GAGACATGTA TGTGTTCCTC
TGATGAAATC CTTTTAAAAT AGTTTATTTT GTTCTTGAAC TTTAGTTCCT TAGCTAACAC AATCTATAAT CGGTTCAGGG
CTGAAGCTAT TAAAAGAGCT AATGGTACAT ATTTCTCTGA GGAGGTGTGG ATTCTGACCT TGCATTTCCT TTGATACCTT
AAAAATTGCT TTGCTGCAAA CAAGGGATGT GCACTGAAAT GTTTTTCTCA TTTTTTTTTC AGAAGCTTTG CAAATGGCTT
GTGCAACTTC TCATGGCTCT AGATTATTTA CATGCAAACC ACATTCTTCA CCGAGATGTC AAGGTCAGTA GTAGTGCTAA
ACTTGGGAGT ACCTTATAGT ATTTATATTT CCATGGCATG GAAATAATAT ATACTAAAGC TGCTAAAAAT TCGTTTCAGT
GCTCCAATAT TTTCATTGCC AGGGACCAAA GTATAAGACT TGGTATGTAT CTTAGTCCCA AAAAGTATCA TACTTTATGT
ATGGGTTTAG CAATCCTGGT AATGTTGCAA TTCCAAATTT AAACCAATGC AGGTGACTTT GGGCTTGCAA AAATATTGAC
TTCTGATGAT CTGGCATCTT CTGTAAGTAA TTGTAGCACT TTTCATATTT CCAGTACATA TTCGATGTCA CTCTTAGTAG
TATATTGCTC CCAACACAGG TAGTAGGAAC ACCAAGTTAC ATGTGTCCAG AACTTCTTGC TGATATACCA TATGGTACCA
AGTCAGATAT TTGGTCTCTA GGTATATATG ACTTCAATTT GAGAAACCAC TTTCCTGCCC TAAATGGAAA ACTTACTATT
GAACTCTCAT TTTTATTACT TTGTTTCAGG ATGTTGTATA TATGAAATGA CCGCGCTCAG GCCTGCATTT AAAGCTTTTG
TAAGTCCCTG TTTTGGTTTC TTTACTTTTA CTGTGTGATG GTTTATTTGA GCATATGTTT AGATACTACA TCTATGCTAA
TAGTAATGCA GTGTTATGAA ACGTACAAGG GTCTAATTTT CTCATTTCCC TGCAGGACAT GCAAGCGCTG ATTAACAAGA
TCACGAAATC AATAGTCTCA CCATTACCCA CTAAATATTC TGGTGCCTTG TAAGTTTTGA ACTAGTTGCC TTTTGTTGTT
TCACCCTATT TTGCCCACCA TCTTATCTGG ATAGAGCATG CTTCTTAAAT TTATATTCTG CGTGCAGTAG GGGACTTATT
AAGAGCATGC TGCGGAAAAG TCCAGAGCAC AGACCTAGTG TAAGTCCATT ATACTATATC CTAGTTACTA CTTTGTAATA
GTTGCTGATG TATACTCCTA TTTGTTTTGT GGTATAAATA TTTACTAAAT TTCCTGTACA GGCTGCACAG CTACTCAAGC
ATCCACAACT TCAGCCTTAT GTGCTGCAAG TCCAATTGAA ATCTAGTCCT ACTCGCAACA TACTTCCAAT CCATCAATCT
TTGACTGACA AAGTTAAGAA GATGACATTT CCTAGTGACG TGGTTGATTC TGCACGCAGA AGAATGGCCA GGAGGAACTC
TCTGGGAAAT GAGAGGACTG TGACATTTAG CAAGCCATCT CCGGAACGGA ATTCAGTTAG CTCTACACGG AGCATCAAAG
AATACACAAC CACCCAGAGT GTCAAAGGGC TCTCTGTTGA CAGTAGTGAG GCTGGGGATG AGGTTACCAG TAAAGCCATC
ATAACAAAGA CATCAAGCAT CCTAAGGACG CCCAAGAGCT TGCCAGCCAA GACTTATACA GCTAGAAATC AGCTTGAACC
TCCCAAAACA TCGTATAACA GAACATACCG CTCTGAGGTA TTCCATTTTG TGCCTTTTTT TTCTATATTA TTTGTGCACT
CAATAATACC AGTGAACCTG TTCTTCATTT GTTTAGAAAC TACAATAGCC TCAATTATAG CATGTGCTTG CTCAGTGCAT
ACTACATTAG TGTTATTCAG CTTTTGGTCT TTTAGAGTTA TTAAGATCTT GTCATGATGC AGTTGTTTCT TTATGCTATT
TATGGCTTCA GCACGAGCTT GCATTTTGCA TGATTATGCT GCCTCTTTCA TTATTTGTCT GTTGAAATGA ATGTGCCAAT
ATTCATTGAG CTCCAATTTC TTCCACTTTT ACAGCTGCCC TCAAAAACAA CTCCAAACAA AATTGCCCGA CCAGCAAGAA
GAGCATCACT CCCGCTGTCA ACATATGAAA CACCCACCAA GCGCAGCATC AGCATTCTGG AACAACTAGA CTCCCCTGAC
GTCTCTGTGA ATGCCCCTCG AATCGACAGA ATTGCGGAAT TCCCACTGGC ATCGTCTGAG GACCCCTTGC TCCCCATCCA
CAACAAGCTC TCTCCTGGCC ATGGCTCATG TTCCACTCCT CCCTTTATCA ACCGGTCAAT CACCAAGGAC AAATGCACGA
TCCAGGTGTT ACGCACCGAT GGGGACAACG GGAGCGACTC CTCAGGCCGC AACGCCACTG CTGCCTCGAG CCGCGGATCC
AATGACTCCA GGCAGCAGCG GTTCGACACC TCGTCGTTCC AGCAGCGTGC CGAGGCATTG GAAGGGCTGC TGGAGTTCAG
CGCGCAGCTG CTGCAGCAGG AGAGGTATGA GGAGCTGGGC ATTCTGCTGA AGCCATTCGG ACCGGAGAAA GCGTCTCCCA
GGGAGACGGC CATCTGGCTC ACAAAGAGCT TCAAGGAGAC GGCATCATAG CGCCACCTTG TATCAGGCGC GTCTAAAATC
GCCAGTTTTG TCATGTGCAA TATTAGCTCA GGTAGTGGTA AACAATATTT AGGATTTGAG ACTTTTAGCT GTTGGGAGGC
AGCACCATCT CAGTGTTGCT GTTAACTCAA AATCTACTTC TAGCTCTAGC TAGTTTCCAG TTTTTTACTT TCTATTAGGA
ATCAGCAATC AGCAGCAGGA GTTGTAGTAG TAGAACTGTA AGTTAAGCTG AAGATCTTGC AAGATCTTAG AACCTTTGTA
ATCATGTGGC ACCTGCAATC ATGTAGTGAT ATAAATGTGG GGTTAAGGAT ATCC

Locus: Os12g0604700

Loading...

Locus: Os12g0604700

Loading...