Os12t0604700-02

Locus

Os12g0604700

Description

Similar to cDNA clone:J023075D08, full insert sequence.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsNek2

Oryzabase Gene Name Synonym(s)

NIMA-related kinase 2

Transcript Evidence

AK101826 (DDBJ, Best hit)

Protein Evidence

B7EKP8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase-like domain (IPR011009)

Full-length cDNA

J033068B03 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0604700-02)

RiceXPro (AK101826)

Others

Oryzabase (9926)

KEGG (Os12t0604700-02)

Transcript

1476 bp

>Os12t0604700-02 Similar to cDNA clone:J023075D08, full insert sequence.
GACATGCAAGCGCTGATTAACAAGATCACGAAATCAATAGTCTCACCATTACCCACTAAA
TATTCTGGTGCCTTTAGGGGACTTATTAAGAGCATGCTGCGGAAAAGTCCAGAGCACAGA
CCTAGTGCTGCACAGCTACTCAAGCATCCACAACTTCAGCCTTATGTGCTGCAAGTCCAA
TTGAAATCTAGTCCTACTCGCAACATACTTCCAATCCATCAATCTTTGACTGACAAAGTT
AAGAAGATGACATTTCCTAGTGACGTGGTTGATTCTGCACGCAGAAGAATGGCCAGGAGG
AACTCTCTGGGAAATGAGAGGACTGTGACATTTAGCAAGCCATCTCCGGAACGGAATTCA
GTTAGCTCTACACGGAGCATCAAAGAATACACAACCACCCAGAGTGTCAAAGGGCTCTCT
GTTGACAGTAGTGAGGCTGGGGATGAGGTTACCAGTAAAGCCATCATAACAAAGACATCA
AGCATCCTAAGGACGCCCAAGAGCTTGCCAGCCAAGACTTATACAGCTAGAAATCAGCTT
GAACCTCCCAAAACATCGTATAACAGAACATACCGCTCTGAGCTGCCCTCAAAAACAACT
CCAAACAAAATTGCCCGACCAGCAAGAAGAGCATCACTCCCGCTGTCAACATATGAAACA
CCCACCAAGCGCAGCATCAGCATTCTGGAACAACTAGACTCCCCTGACGTCTCTGTGAAT
GCCCCTCGAATCGACAGAATTGCGGAATTCCCACTGGCATCGTCTGAGGACCCCTTGCTC
CCCATCCACAACAAGCTCTCTCCTGGCCATGGCTCATGTTCCACTCCTCCCTTTATCAAC
CGGTCAATCACCAAGGACAAATGCACGATCCAGGTGTTACGCACCGATGGGGACAACGGG
AGCGACTCCTCAGGCCGCAACGCCACTGCTGCCTCGAGCCGCGGATCCAATGACTCCAGG
CAGCAGCGGTTCGACACCTCGTCGTTCCAGCAGCGTGCCGAGGCATTGGAAGGGCTGCTG
GAGTTCAGCGCGCAGCTGCTGCAGCAGGAGAGGTATGAGGAGCTGGGCATTCTGCTGAAG
CCATTCGGACCGGAGAAAGCGTCTCCCAGGGAGACGGCCATCTGGCTCACAAAGAGCTTC
AAGGAGACGGCATCATAGCGCCACCTTGTATCAGGCGCGTCTAAAATCGCCAGTTTTGTC
ATGTGCAATATTAGCTCAGGTAGTGGTAAACAATATTTAGGATTTGAGACTTTTAGCTGT
TGGGAGGCAGCACCATCTCAGTGTTGCTGTTAACTCAAAATCTACTTCTAGCTCTAGCTA
GTTTCCAGTTTTTTACTTTCTATTAGGAATCAGCAATCAGCAGCAGGAGTTGTAGTAGTA
GAACTGTAAGTTAAGCTGAAGATCTTGCAAGATCTTAGAACCTTTGTAATCATGTGGCAC
CTGCAATCATGTAGTGATATAAATGTGGGGTTAAGG

CDS

1158 bp

>Os12t0604700-02 Similar to cDNA clone:J023075D08, full insert sequence.
GACATGCAAGCGCTGATTAACAAGATCACGAAATCAATAGTCTCACCATTACCCACTAAA
TATTCTGGTGCCTTTAGGGGACTTATTAAGAGCATGCTGCGGAAAAGTCCAGAGCACAGA
CCTAGTGCTGCACAGCTACTCAAGCATCCACAACTTCAGCCTTATGTGCTGCAAGTCCAA
TTGAAATCTAGTCCTACTCGCAACATACTTCCAATCCATCAATCTTTGACTGACAAAGTT
AAGAAGATGACATTTCCTAGTGACGTGGTTGATTCTGCACGCAGAAGAATGGCCAGGAGG
AACTCTCTGGGAAATGAGAGGACTGTGACATTTAGCAAGCCATCTCCGGAACGGAATTCA
GTTAGCTCTACACGGAGCATCAAAGAATACACAACCACCCAGAGTGTCAAAGGGCTCTCT
GTTGACAGTAGTGAGGCTGGGGATGAGGTTACCAGTAAAGCCATCATAACAAAGACATCA
AGCATCCTAAGGACGCCCAAGAGCTTGCCAGCCAAGACTTATACAGCTAGAAATCAGCTT
GAACCTCCCAAAACATCGTATAACAGAACATACCGCTCTGAGCTGCCCTCAAAAACAACT
CCAAACAAAATTGCCCGACCAGCAAGAAGAGCATCACTCCCGCTGTCAACATATGAAACA
CCCACCAAGCGCAGCATCAGCATTCTGGAACAACTAGACTCCCCTGACGTCTCTGTGAAT
GCCCCTCGAATCGACAGAATTGCGGAATTCCCACTGGCATCGTCTGAGGACCCCTTGCTC
CCCATCCACAACAAGCTCTCTCCTGGCCATGGCTCATGTTCCACTCCTCCCTTTATCAAC
CGGTCAATCACCAAGGACAAATGCACGATCCAGGTGTTACGCACCGATGGGGACAACGGG
AGCGACTCCTCAGGCCGCAACGCCACTGCTGCCTCGAGCCGCGGATCCAATGACTCCAGG
CAGCAGCGGTTCGACACCTCGTCGTTCCAGCAGCGTGCCGAGGCATTGGAAGGGCTGCTG
GAGTTCAGCGCGCAGCTGCTGCAGCAGGAGAGGTATGAGGAGCTGGGCATTCTGCTGAAG
CCATTCGGACCGGAGAAAGCGTCTCCCAGGGAGACGGCCATCTGGCTCACAAAGAGCTTC
AAGGAGACGGCATCATAG

Protein

386 aa

>Os12t0604700-02 Similar to cDNA clone:J023075D08, full insert sequence.
DMQALINKITKSIVSPLPTKYSGAFRGLIKSMLRKSPEHRPSAAQLLKHPQLQPYVLQVQ
LKSSPTRNILPIHQSLTDKVKKMTFPSDVVDSARRRMARRNSLGNERTVTFSKPSPERNS
VSSTRSIKEYTTTQSVKGLSVDSSEAGDEVTSKAIITKTSSILRTPKSLPAKTYTARNQL
EPPKTSYNRTYRSELPSKTTPNKIARPARRASLPLSTYETPTKRSISILEQLDSPDVSVN
APRIDRIAEFPLASSEDPLLPIHNKLSPGHGSCSTPPFINRSITKDKCTIQVLRTDGDNG
SDSSGRNATAASSRGSNDSRQQRFDTSSFQQRAEALEGLLEFSAQLLQQERYEELGILLK
PFGPEKASPRETAIWLTKSFKETAS*

CDS

chr12:25520157..25520230 (- strand) : 74 bp

chr12:25520007..25520058 (- strand) : 52 bp

chr12:25519449..25519904 (- strand) : 456 bp

chr12:25518556..25519131 (- strand) : 576 bp

3'UTR

chr12:25518238..25518555 (- strand) : 318 bp

FASTA

>Os12t0604700-02 class=Sequence position=chr12:25518238..25520230 (- strand)
GACATGCAAG CGCTGATTAA CAAGATCACG AAATCAATAG TCTCACCATT ACCCACTAAA TATTCTGGTG CCTTGTAAGT
TTTGAACTAG TTGCCTTTTG TTGTTTCACC CTATTTTGCC CACCATCTTA TCTGGATAGA GCATGCTTCT TAAATTTATA
TTCTGCGTGC AGTAGGGGAC TTATTAAGAG CATGCTGCGG AAAAGTCCAG AGCACAGACC TAGTGTAAGT CCATTATACT
ATATCCTAGT TACTACTTTG TAATAGTTGC TGATGTATAC TCCTATTTGT TTTGTGGTAT AAATATTTAC TAAATTTCCT
GTACAGGCTG CACAGCTACT CAAGCATCCA CAACTTCAGC CTTATGTGCT GCAAGTCCAA TTGAAATCTA GTCCTACTCG
CAACATACTT CCAATCCATC AATCTTTGAC TGACAAAGTT AAGAAGATGA CATTTCCTAG TGACGTGGTT GATTCTGCAC
GCAGAAGAAT GGCCAGGAGG AACTCTCTGG GAAATGAGAG GACTGTGACA TTTAGCAAGC CATCTCCGGA ACGGAATTCA
GTTAGCTCTA CACGGAGCAT CAAAGAATAC ACAACCACCC AGAGTGTCAA AGGGCTCTCT GTTGACAGTA GTGAGGCTGG
GGATGAGGTT ACCAGTAAAG CCATCATAAC AAAGACATCA AGCATCCTAA GGACGCCCAA GAGCTTGCCA GCCAAGACTT
ATACAGCTAG AAATCAGCTT GAACCTCCCA AAACATCGTA TAACAGAACA TACCGCTCTG AGGTATTCCA TTTTGTGCCT
TTTTTTTCTA TATTATTTGT GCACTCAATA ATACCAGTGA ACCTGTTCTT CATTTGTTTA GAAACTACAA TAGCCTCAAT
TATAGCATGT GCTTGCTCAG TGCATACTAC ATTAGTGTTA TTCAGCTTTT GGTCTTTTAG AGTTATTAAG ATCTTGTCAT
GATGCAGTTG TTTCTTTATG CTATTTATGG CTTCAGCACG AGCTTGCATT TTGCATGATT ATGCTGCCTC TTTCATTATT
TGTCTGTTGA AATGAATGTG CCAATATTCA TTGAGCTCCA ATTTCTTCCA CTTTTACAGC TGCCCTCAAA AACAACTCCA
AACAAAATTG CCCGACCAGC AAGAAGAGCA TCACTCCCGC TGTCAACATA TGAAACACCC ACCAAGCGCA GCATCAGCAT
TCTGGAACAA CTAGACTCCC CTGACGTCTC TGTGAATGCC CCTCGAATCG ACAGAATTGC GGAATTCCCA CTGGCATCGT
CTGAGGACCC CTTGCTCCCC ATCCACAACA AGCTCTCTCC TGGCCATGGC TCATGTTCCA CTCCTCCCTT TATCAACCGG
TCAATCACCA AGGACAAATG CACGATCCAG GTGTTACGCA CCGATGGGGA CAACGGGAGC GACTCCTCAG GCCGCAACGC
CACTGCTGCC TCGAGCCGCG GATCCAATGA CTCCAGGCAG CAGCGGTTCG ACACCTCGTC GTTCCAGCAG CGTGCCGAGG
CATTGGAAGG GCTGCTGGAG TTCAGCGCGC AGCTGCTGCA GCAGGAGAGG TATGAGGAGC TGGGCATTCT GCTGAAGCCA
TTCGGACCGG AGAAAGCGTC TCCCAGGGAG ACGGCCATCT GGCTCACAAA GAGCTTCAAG GAGACGGCAT CATAGCGCCA
CCTTGTATCA GGCGCGTCTA AAATCGCCAG TTTTGTCATG TGCAATATTA GCTCAGGTAG TGGTAAACAA TATTTAGGAT
TTGAGACTTT TAGCTGTTGG GAGGCAGCAC CATCTCAGTG TTGCTGTTAA CTCAAAATCT ACTTCTAGCT CTAGCTAGTT
TCCAGTTTTT TACTTTCTAT TAGGAATCAG CAATCAGCAG CAGGAGTTGT AGTAGTAGAA CTGTAAGTTA AGCTGAAGAT
CTTGCAAGAT CTTAGAACCT TTGTAATCAT GTGGCACCTG CAATCATGTA GTGATATAAA TGTGGGGTTA AGG

Locus: Os12g0604700

Loading...

Locus: Os12g0604700

Loading...