Os12t0613000-01

Locus

Os12g0613000

Description

Similar to NF-YA subunit.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP2B

CGSNL Gene Name

HAP2 SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP2B, NF-YA, CBF-B, NF-YA9, OsNF-YA9, NFYA9

Oryzabase Gene Name Synonym(s)

NUCLEAR FACTOR-Y subunit A9, NUCLEAR FACTOR-Y subunit NF-YA9, NF-YA transcription factor 9, NF-YA subunit 9, NF-YA family 9

Transcript Evidence

AK065163 (DDBJ, Best hit)

Protein Evidence

B6TY54 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Cellular Component: CCAAT-binding factor complex (GO:0016602)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Functional domain (InterPro)

CCAAT-binding transcription factor, subunit B (IPR001289)

CCAAT-binding factor, conserved site (IPR018362)

Full-length cDNA

J013002C07 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0613000-01)

RiceXPro (AK065163)

Others

Oryzabase (8474)

KEGG (Os12t0613000-01)

Transcript

1311 bp

>Os12t0613000-01 Similar to NF-YA subunit.
CTTCTCATCTCATCTCCCTCTCCTCTCCTCTCGCCGTCGCCGTCGCCGTCGCCGCCGCTC
GCCGCCGGCGGGGATAGAGTTCGCCGGGATCGCCTCGCCGGGAGAGTTCCCTCACCATCC
CGCACCTCCGCTCGCCTGGCCTCTTCCTCCCGGAAGTGTGGTGTGCTGCAAGCTCCTGTC
TCTCCTACAAGGTTTCAAAACCAAAATATGCCTGAAGCACACGGAAAGCTGGGGTGATTA
ACGTCTGTTTCTTTTGACTACAATCATCCTGATTCTGCTTCTGTCTGCAAAAACAACCAA
GCCATGACGTCTGTAGTTCATGATGTTTCAGGCAACCATGGAGCTGATGAGCGGCAAAAA
CAGCAAAGGCAAGGTGAACCTGAGGACCAGCAAGAAGCCTCAGTTACTAGTACAGATAGC
CATACAATGGTAGCAACACCTTCAACAGATTATGCGACACCCTATGCCCATCACGATATG
GCCCATGCAATGGGCCAAATTGCTTACGCAAATATTGATCCATATTACGGAAGCCTTTAT
GCAGCTTATGGTGGACAGCCTATGATGCATCCACCATTGGTCGGGATGCATCCAGCTGGA
CTACCACTGCCTACCGATGCAATTGAAGAGCCTGTCTATGTTAATGCAAAACAGTACAAT
GCCATATTAAGGCGTCGACAATCTCGAGCCAAAGCTGAGTCTGAAAAGAAGCTTGTCAAG
GGCCGTAAGCCATATCTCCATGAGTCACGGCATCAACATGCCCTGAAAAGGGCTAGGGGA
GCTGGAGGCCGATTTCTTAATTCAAAATCGGATGACAAGGAAGAGCATTCTGATTCCAGT
TCCAGAGATAAACAGGATGGAGTTGCACCCCGTGATAGTGGCCAACCGTCTACCTCTCCG
TCTTCAAAGGGTGCATCATCAGCTAAACAAAATAAGAAGTCAAAAACCAGTAACTAAACG
GGATTTAAGCACCTGGTGTGAAACATGGAAACAGTTTTGTACAGTACATGCTAGTGATCG
ACAAAGAATGGTGTCATTGGGTGTTGTAGGATAATGCTCCATAGAGAATATATAGACAGG
GCAACAGATTTTGCAGCCTTTGGTTCGGTCTGCTCAGTTTCTTTACCTTCTTGTACAATG
AGTAGTTTTCGTCAGTTGTGCTTTGTCATGGGGATAGCTGAATTTCTTCAGGAAGTCTTG
TAGTTTTAAAGAGTTCATTAGCTTGCCAATTGTTTGCTTTGGATTGGATTGGTCTCTTAC
TGCCTTTGCATCATCATCTGCAGTGCACAGAATAAAACATTGGCTATGTGT

CDS

654 bp

>Os12t0613000-01 Similar to NF-YA subunit.
ATGACGTCTGTAGTTCATGATGTTTCAGGCAACCATGGAGCTGATGAGCGGCAAAAACAG
CAAAGGCAAGGTGAACCTGAGGACCAGCAAGAAGCCTCAGTTACTAGTACAGATAGCCAT
ACAATGGTAGCAACACCTTCAACAGATTATGCGACACCCTATGCCCATCACGATATGGCC
CATGCAATGGGCCAAATTGCTTACGCAAATATTGATCCATATTACGGAAGCCTTTATGCA
GCTTATGGTGGACAGCCTATGATGCATCCACCATTGGTCGGGATGCATCCAGCTGGACTA
CCACTGCCTACCGATGCAATTGAAGAGCCTGTCTATGTTAATGCAAAACAGTACAATGCC
ATATTAAGGCGTCGACAATCTCGAGCCAAAGCTGAGTCTGAAAAGAAGCTTGTCAAGGGC
CGTAAGCCATATCTCCATGAGTCACGGCATCAACATGCCCTGAAAAGGGCTAGGGGAGCT
GGAGGCCGATTTCTTAATTCAAAATCGGATGACAAGGAAGAGCATTCTGATTCCAGTTCC
AGAGATAAACAGGATGGAGTTGCACCCCGTGATAGTGGCCAACCGTCTACCTCTCCGTCT
TCAAAGGGTGCATCATCAGCTAAACAAAATAAGAAGTCAAAAACCAGTAACTAA

Protein

218 aa

>Os12t0613000-01 Similar to NF-YA subunit.
MTSVVHDVSGNHGADERQKQQRQGEPEDQQEASVTSTDSHTMVATPSTDYATPYAHHDMA
HAMGQIAYANIDPYYGSLYAAYGGQPMMHPPLVGMHPAGLPLPTDAIEEPVYVNAKQYNA
ILRRRQSRAKAESEKKLVKGRKPYLHESRHQHALKRARGAGGRFLNSKSDDKEEHSDSSS
RDKQDGVAPRDSGQPSTSPSSKGASSAKQNKKSKTSN*

5'UTR

chr12:25957180..25957331 (- strand) : 152 bp

chr12:25956413..25956563 (- strand) : 151 bp

CDS

chr12:25956385..25956412 (- strand) : 28 bp

chr12:25955719..25955879 (- strand) : 161 bp

chr12:25955051..25955122 (- strand) : 72 bp

chr12:25954699..25954863 (- strand) : 165 bp

chr12:25953828..25954055 (- strand) : 228 bp

3'UTR

chr12:25953474..25953827 (- strand) : 354 bp

FASTA

>Os12t0613000-01 class=Sequence position=chr12:25953474..25957331 (- strand)
CTTCTCATCT CATCTCCCTC TCCTCTCCTC TCGCCGTCGC CGTCGCCGTC GCCGCCGCTC GCCGCCGGCG GGGATAGAGT
TCGCCGGGAT CGCCTCGCCG GGAGAGTTCC CTCACCATCC CGCACCTCCG CTCGCCTGGC CTCTTCCTCC CGGTCAGTAA
GCCCGCCTTC TCCCTCTCGC TTTCTGTTCT GCTCTGCTCT GCTCCTTTTG CTTTTCTGGA GGGAGGAAGT TTGCGAGGAG
AATTCCCGTT TCCCCCTCCG AATCCGTGAA CCCACACTCG TTTCCCCACG GCGGCAAGAA TTTCGGGTAG AATTCGACAA
ACAATATCTA TCCCTGTGTT GTGCGGTTCT TGTTTGCGTT GGTGAGGTTT GGAAGGTGGG AGGTCAAAGG GCTAAGCAAT
CATCAGATAA TCCTGTCTTG ATATATCCGG TATTCGTTAA TGATTTTCAC ACGAGTCTGA AAAAAATCTT CGCCTACCAA
TTGTCGCTGT ACTTTTCACA CCTACAATGA GACATTAATG TTAATGCAGT CTGAATAATT TTGTCGAAAT TATAGATAAT
GGTGGAGGTT ATGTGTCACT CATCACTGTG TTGCCTCAAG TCTCAAGACC TAGATATGCA TGCACGATCC CTGCCTTTCT
TAAAGGACTA TTTTATCAGC TTTGTTGTAG TTTGAATGGA AGTTTTTTTT GTGTTTAGGA TCAAATGATG CGGTTTATGT
TGGTTCTTAG GATCACTGAA GCTTCAATTC AACTTTGTTC ATTGGCAGGA AGTGTGGTGT GCTGCAAGCT CCTGTCTCTC
CTACAAGGTT TCAAAACCAA AATATGCCTG AAGCACACGG AAAGCTGGGG TGATTAACGT CTGTTTCTTT TGACTACAAT
CATCCTGATT CTGCTTCTGT CTGCAAAAAC AACCAAGCCA TGACGTCTGT AGTTCATGAT GTTTCAGGTA TGTCTGTTTC
ATCCACCAAT GTTTGCCTTG TATATTTACT CATGTTTAAA TAGTGGGGTA GTGTCTGGTT ATAAATTGTA ATCACAACAA
TGATTGCTCA ACTGTAAATT CCATTGGGAG TGTATTGAGC ACGCATGACG GTTATGGATT TTTCCAAGCA AACAGTGGCA
TTTGTATTAG CAGACAGTGG CATTTACGTG GACAATTAGT AACCAGGTAT AGAAGGCAAT TTGAATTTAT TAAGGTATAT
TATTATTCCA GATGCAGCCT GTCACACTGA ATTTATAGCT GGTGGGATTA TGGAAATATT AGTTGTTCCA TTAAGTTGGC
ATACACTCTG CAGTGTTTAG ATCAATTACT ACATGTAAAA AGGACGTGCT GAAGTGTTGA TGGAACATCC ATCGATGCTT
GCTAAGTGCT GGCAGATATA ATTTCAGTTA TTCCCCTTTT TAAAAATGGC AATACTTTAA GCCTTTTCAT TTTTGTTTTC
TTTCCTATGT AGGCAACCAT GGAGCTGATG AGCGGCAAAA ACAGCAAAGG CAAGGTGAAC CTGAGGACCA GCAAGAAGCC
TCAGTTACTA GTACAGATAG CCATACAATG GTAGCAACAC CTTCAACAGA TTATGCGACA CCCTATGCCC ATCACGATAT
GGCCCATGCA ATGGTACATT ACATGTATTT TTTCCCTTTT TTAGTTATGA GCAAGTAGTA TAACTTCTGT TCTTTCAGTT
TGAGCCCTAG TCTAAGGATA TTTAGCCAAC TGATCATAGT GAAATATGGG AGAAACATGG CAGGCTTGTA GAATCACTAT
GGAGATTCAA GTTTGAATTT GGATTTGGAT TCTTGGGCTG ATAACCACCT CTTCATACTA AAACTAACAG ATATACAGAG
AGAAAAACTC TTGCATAGTG GAGGACCAAT TTACTTCCTT TTGAGGTGAC CCTCTTATGA AAACCATGCA TCACACCTTG
ATTGTCAAAC AGGTGCACAT GACTTCCATG ACAGTTATAC CATATCCCAT TTATACTGCT ATGCCACGTT TCCTTGATAC
GTTGTCAACA AATGTTCACC AGTCCATAAC ACAAGTCTCC ACACGACCAC AGATAGCCAA ATTTCTTTGT TACTAACCTT
AACCAAAGAG AGCGTTGGTG GTTGCACCAT GAGTTGCTTC TTTGCTTGGA TTTCCTGATC ACAGTTCATG CATAACGCCA
AATTCCATTT GTAATGTTTA TTGTCTAATT CTGCATTTTT TTTCAGCAGG GCCAAATTGC TTACGCAAAT ATTGATCCAT
ATTACGGAAG CCTTTATGCA GCTTATGGTG GACAGCCTAT GGTAAGCTCT CATGTACAAA TTATTATAGC TGCATGTACT
TTGCGTGGGG AGGGTAGGCC AGTATCTCAT AGCCTTTTAT AACCTGATCC GTCGCATCCG GACAAAAAAA AACAATTACG
TAATTCTGGG TCTTTGTATG CTACTTCCAC TCTCTGTTAA AATGTTTTTG TGATGTTCCT TTTTTCAGAT GCATCCACCA
TTGGTCGGGA TGCATCCAGC TGGACTACCA CTGCCTACCG ATGCAATTGA AGAGCCTGTC TATGTTAATG CAAAACAGTA
CAATGCCATA TTAAGGCGTC GACAATCTCG AGCCAAAGCT GAGTCTGAAA AGAAGCTTGT CAAGGGCCGT AAGGTAAATC
TTATTAGCAC CTTTTACGAA ACCATATAAC ATGGAATATT AATTAGTTAT CCTTTTCCTG ATGCTTCATT ATAGTTCGAG
TTGGTCAGAA GCACAAGTGA ACAACAACTT GCTTCAAGTA GTCGACTAAA TTCTCCAATC TACATATCCC ACTTCCATAC
TAAGATCAAT CTGCTCTACT GTAAATCTTA TGGTGAATAT ACATCCAATC TTTTATCATG TCTAGCATAC CAAGTTTCCA
ATGTCTTCTG GCTATTGCTC ATTGTAAAAC ATTAAGGATC TGGGAATTGG ATACCACACA ACAAGAAATT TGTGTCAAAT
ATGGATGTGG GTTGATTTTG CTCTCTATTT CCATGTAAAT TTGTAAGTTC AAGCTGTGCC TTTTTCACTT CTTTTTGTAC
CAAAATAATA CAAACTCTTG TTACTTGGAT CACTGCATTG GTTCTAATCT TGACAGAGTT TAAGGTTGGC ACTTTCTGTC
AGAAGTTAAG TTAGGACTTC CACAAAATTA TACCATCTCT GGGTGTTCTT ATAGGTGTTT CTCACTATCA GGAATGTACA
GTTCTTGCAG CTGTCAAGTT CTTTGTACCT ATGTTTCTGT ATCTTCTAAA GATTTTGATT CGTCTGCACT GTGCAGCCAT
ATCTCCATGA GTCACGGCAT CAACATGCCC TGAAAAGGGC TAGGGGAGCT GGAGGCCGAT TTCTTAATTC AAAATCGGAT
GACAAGGAAG AGCATTCTGA TTCCAGTTCC AGAGATAAAC AGGATGGAGT TGCACCCCGT GATAGTGGCC AACCGTCTAC
CTCTCCGTCT TCAAAGGGTG CATCATCAGC TAAACAAAAT AAGAAGTCAA AAACCAGTAA CTAAACGGGA TTTAAGCACC
TGGTGTGAAA CATGGAAACA GTTTTGTACA GTACATGCTA GTGATCGACA AAGAATGGTG TCATTGGGTG TTGTAGGATA
ATGCTCCATA GAGAATATAT AGACAGGGCA ACAGATTTTG CAGCCTTTGG TTCGGTCTGC TCAGTTTCTT TACCTTCTTG
TACAATGAGT AGTTTTCGTC AGTTGTGCTT TGTCATGGGG ATAGCTGAAT TTCTTCAGGA AGTCTTGTAG TTTTAAAGAG
TTCATTAGCT TGCCAATTGT TTGCTTTGGA TTGGATTGGT CTCTTACTGC CTTTGCATCA TCATCTGCAG TGCACAGAAT
AAAACATTGG CTATGTGT

Locus: Os12g0613000

Loading...

Locus: Os12g0613000

Loading...