Os12t0613200-01

Locus

Os12g0613200

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET43, SDG717

Oryzabase Gene Name Synonym(s)

SET protein 43

Transcript Evidence

AK100275 (DDBJ, Best hit)

Protein Evidence

B9GE94 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

GYF (IPR003169)

Full-length cDNA

J023073B16 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0613200-01)

Others

Oryzabase (13406)

Transcript

2885 bp

>Os12t0613200-01 Hypothetical conserved gene.
GAGAGAGAGAGAGAGGCTCATCGCCAATCCGACCAACGCAACCACTCCAACCCACCGGCG
GCGGCGGCGGCGGCGGTGGGGCGCGGCGACCCGGCACCACGCGACCCCGGCGTCGCCATG
CCGCACTCGCGCTCCGATTCGGGGTCGGGTTCCCGCGGCGCTGACCCTTGCCGTGGGAGG
AAGCGCGGGAGGCTGTTGATGCTCGAGGAGGAGGAGGAGGAGGAGGAGTCGGGGATGGAG
GGGTGCTCGGCGCCAGCATGCGGCGATGTGCGGGGGGATTTCGTTGGATGGTGTTCGGAC
CGGCATCAGGTGGCTTCCTGCAGCGGCGACCAGACGCAAAGCGCCAGCATGTTTGCCGCG
ATGCAGGAGAACGCCTGCTCCATCGATAGCAAAGGTGTGGTGTGTCCGCAGTCCGGGCTA
GGGTATTCAGCTGGCCAGAACGGGACGCACGGTGGTGGCGGGTCTATGCTGCATCAGAAT
TTGGAAGGCTGCATGTATATGAATCAGCTTGGGCAGATGTGCGGCCCTTATCCACCTGAA
CAACTGTACGATGGATTATCCACTGGTTTCTTGCATCGAGACCTTGCTATTTATGCCGTT
TTTGGTGGGAAAATGGCCAACCCTGTTTCCTTAGGTTCCCTGAAACAGTTTCTTTCACAA
TGGAGTTCTGATTCTGTGGTCGCCACAAGAGACGAATCGGTGGAGAATAAGAAAATGGCC
CCTGTTAACAAATTGATTCTTCCTGATAATCTTTCAAGTGAAGAATCATGTTGGATGTTT
GAGGACGCAGAAGGCCGCAGGCATGGGCCACATTCTCTTGCTGAACTTTCTTATTGGCAT
CACAGTAGCTATCTACATGACCTTTCAATGATTTACCATGTTGATAGCAAGTTTGGCCCA
TTTACACTTGTATCACTAATTGATTGGTGGAGTGGAGGCACAGAGCATTCAGAATCTTCA
GCCAATGATTCTGGGTCACTGAACGCTTTAATGGATGATGTAGTTGAAGATATCAGCCAT
CAGCTGCATGCTGGAATTATGAAATCAGCCCGCAAAGTTTTTATTGATGAAATATTTAGC
AGCGTACTTCCAGAAATGATTGCTTGCAGGAAGACAGAGAAGCAAATGGCTGCAAAACGT
AAGAGCCAAGCTGCTAAGACTGACAATGTGAGTAACAAGAATGCTTTGGTACTTAAGGGC
AAGGGTGATGGAACATCTACTCGTCCAAAAAGCCTAAACTCGTATAATAATAAAGTACCG
GAAGATCCTTCTGTGGCTGTTCAATCAACTGCAATGCAGTATGAATTTGCTGATATATTA
TCGGCAGTTTGGGAAACAATTTATAACAAATCCATGAAGAGTATCTGGGATGAAGTACTG
TATGATCCTGTCATGGACTACTGTGATGCATGGCTTAAAAGAAAAAATGAGTCGAATCTT
CTCTCTACAGTTGTTCCTGGAGCCTCTGATAACCAAAAGATGCAAGACACAGATGAAATG
TCACCAAAGGCAATTTGTGATTCAGATGCTCCTGAAAGTGACATGGATTTCCCTCCAGGA
TTTGGACCAAATCAGGAATCTGCTGAGCATTCCCACTCTGCGTGTGTTGAGTATGTTACT
GAAAAAACAGATGGGAGGTCTGGATCAAGTATCACGTTGTTTTCTGGCCCCTTAGGACGA
GTTCAGGTAATGCTGGCAAATGAACTATATGTGGCAGCAAAGGAAGCTTTGTTCCAGCAT
TTTGAGGAGGTCATTTCAGAGGAGATAACAAACTGTTTGTGCATTGGATTTGAAGATGAT
ATTAATCAAGAACGAATTCGTACGCCTGTTCACGCACCAGAACCATCCAGTCCTCCTGGA
ATATCTGTGCATGAAACGCCCAGTCCTGCTGAAATGCCTCGAGATGAAATTTCGGATATG
GCTGAAATGGCTCGAGATGAAATTTCAGATATGGCTGTAGATACAATACCCTGCCCTGCT
GATATGGCGGCATCTGGAACATCAACTGTTCCTGAAGTGACAACAGACAAACTGATCATT
CCTTACGTGGAACATCAATCGCCCTCTGCATCTCATGCAAGTATATTTGAAAAGTTGGAT
GCACATGAAGAAGCTGAATTGGATGACAGTTTTGATGAGGTGCCTCCTGGAACAGAGGCT
GGCTTAGCTTCATTGGTGATTATGGAGAAAAACAAATACCAGCCCTCAAAATCAGTAGAC
TCAGTGCTTGACATTTATAGATATACTAGTTGGGCATTCTTCAGGCAAATACTGCATGAG
AGTGTAATGAAAGAGTGGGCATCTCTCTTCTCAGGTGCTCTCAGCAATTGTTTTGACTCA
TGGTATGCCAGGAAAAATATTGTGGCTAAAACCATGGATGATACATTGAGACCCAAAGAA
TATACTTACTACAGGAAGAGGAAACTGAGGAAAAACTGTGAAGCATCATCATCAGAAAAA
CCAATGGATGAGCAGCTCTCCAGACCTCTTCGTGATCTTGTTGAATGCAAGGTTAATATG
AAAAATATCCATCGATCAAGCAAGGCTGGGATTTCGCAGAGAGTTTCTGTTGTGGAGAAG
CCCTCCAAAAAGCGTGCCAAACCTTCACATAATGATAATATTAATCTGAATATCCAGCAG
GACTTGAAACTCCTTTCCGACAAGGTGCCAAAGAGAAACAGGTCTTCCCATCCTACCAGT
AAGCCTCTTGTTAGTAGCAAAGTGCCTACTGAGGATAGAACTACATCAGCAATGCCTGCA
AAGAAAAGAAAGCAGAAAAACTTGGCCACTGAGTCCAACCTGAAGACAAAAGCAGTAATT
TTATCTCCAGAATCACATGGTTGTGAAGCGCCTACTGAGAAAAGAACTACAGCTATAATG
CCTGT

CDS

2768 bp

>Os12t0613200-01 Hypothetical conserved gene.
ATGCCGCACTCGCGCTCCGATTCGGGGTCGGGTTCCCGCGGCGCTGACCCTTGCCGTGGG
AGGAAGCGCGGGAGGCTGTTGATGCTCGAGGAGGAGGAGGAGGAGGAGGAGTCGGGGATG
GAGGGGTGCTCGGCGCCAGCATGCGGCGATGTGCGGGGGGATTTCGTTGGATGGTGTTCG
GACCGGCATCAGGTGGCTTCCTGCAGCGGCGACCAGACGCAAAGCGCCAGCATGTTTGCC
GCGATGCAGGAGAACGCCTGCTCCATCGATAGCAAAGGTGTGGTGTGTCCGCAGTCCGGG
CTAGGGTATTCAGCTGGCCAGAACGGGACGCACGGTGGTGGCGGGTCTATGCTGCATCAG
AATTTGGAAGGCTGCATGTATATGAATCAGCTTGGGCAGATGTGCGGCCCTTATCCACCT
GAACAACTGTACGATGGATTATCCACTGGTTTCTTGCATCGAGACCTTGCTATTTATGCC
GTTTTTGGTGGGAAAATGGCCAACCCTGTTTCCTTAGGTTCCCTGAAACAGTTTCTTTCA
CAATGGAGTTCTGATTCTGTGGTCGCCACAAGAGACGAATCGGTGGAGAATAAGAAAATG
GCCCCTGTTAACAAATTGATTCTTCCTGATAATCTTTCAAGTGAAGAATCATGTTGGATG
TTTGAGGACGCAGAAGGCCGCAGGCATGGGCCACATTCTCTTGCTGAACTTTCTTATTGG
CATCACAGTAGCTATCTACATGACCTTTCAATGATTTACCATGTTGATAGCAAGTTTGGC
CCATTTACACTTGTATCACTAATTGATTGGTGGAGTGGAGGCACAGAGCATTCAGAATCT
TCAGCCAATGATTCTGGGTCACTGAACGCTTTAATGGATGATGTAGTTGAAGATATCAGC
CATCAGCTGCATGCTGGAATTATGAAATCAGCCCGCAAAGTTTTTATTGATGAAATATTT
AGCAGCGTACTTCCAGAAATGATTGCTTGCAGGAAGACAGAGAAGCAAATGGCTGCAAAA
CGTAAGAGCCAAGCTGCTAAGACTGACAATGTGAGTAACAAGAATGCTTTGGTACTTAAG
GGCAAGGGTGATGGAACATCTACTCGTCCAAAAAGCCTAAACTCGTATAATAATAAAGTA
CCGGAAGATCCTTCTGTGGCTGTTCAATCAACTGCAATGCAGTATGAATTTGCTGATATA
TTATCGGCAGTTTGGGAAACAATTTATAACAAATCCATGAAGAGTATCTGGGATGAAGTA
CTGTATGATCCTGTCATGGACTACTGTGATGCATGGCTTAAAAGAAAAAATGAGTCGAAT
CTTCTCTCTACAGTTGTTCCTGGAGCCTCTGATAACCAAAAGATGCAAGACACAGATGAA
ATGTCACCAAAGGCAATTTGTGATTCAGATGCTCCTGAAAGTGACATGGATTTCCCTCCA
GGATTTGGACCAAATCAGGAATCTGCTGAGCATTCCCACTCTGCGTGTGTTGAGTATGTT
ACTGAAAAAACAGATGGGAGGTCTGGATCAAGTATCACGTTGTTTTCTGGCCCCTTAGGA
CGAGTTCAGGTAATGCTGGCAAATGAACTATATGTGGCAGCAAAGGAAGCTTTGTTCCAG
CATTTTGAGGAGGTCATTTCAGAGGAGATAACAAACTGTTTGTGCATTGGATTTGAAGAT
GATATTAATCAAGAACGAATTCGTACGCCTGTTCACGCACCAGAACCATCCAGTCCTCCT
GGAATATCTGTGCATGAAACGCCCAGTCCTGCTGAAATGCCTCGAGATGAAATTTCGGAT
ATGGCTGAAATGGCTCGAGATGAAATTTCAGATATGGCTGTAGATACAATACCCTGCCCT
GCTGATATGGCGGCATCTGGAACATCAACTGTTCCTGAAGTGACAACAGACAAACTGATC
ATTCCTTACGTGGAACATCAATCGCCCTCTGCATCTCATGCAAGTATATTTGAAAAGTTG
GATGCACATGAAGAAGCTGAATTGGATGACAGTTTTGATGAGGTGCCTCCTGGAACAGAG
GCTGGCTTAGCTTCATTGGTGATTATGGAGAAAAACAAATACCAGCCCTCAAAATCAGTA
GACTCAGTGCTTGACATTTATAGATATACTAGTTGGGCATTCTTCAGGCAAATACTGCAT
GAGAGTGTAATGAAAGAGTGGGCATCTCTCTTCTCAGGTGCTCTCAGCAATTGTTTTGAC
TCATGGTATGCCAGGAAAAATATTGTGGCTAAAACCATGGATGATACATTGAGACCCAAA
GAATATACTTACTACAGGAAGAGGAAACTGAGGAAAAACTGTGAAGCATCATCATCAGAA
AAACCAATGGATGAGCAGCTCTCCAGACCTCTTCGTGATCTTGTTGAATGCAAGGTTAAT
ATGAAAAATATCCATCGATCAAGCAAGGCTGGGATTTCGCAGAGAGTTTCTGTTGTGGAG
AAGCCCTCCAAAAAGCGTGCCAAACCTTCACATAATGATAATATTAATCTGAATATCCAG
CAGGACTTGAAACTCCTTTCCGACAAGGTGCCAAAGAGAAACAGGTCTTCCCATCCTACC
AGTAAGCCTCTTGTTAGTAGCAAAGTGCCTACTGAGGATAGAACTACATCAGCAATGCCT
GCAAAGAAAAGAAAGCAGAAAAACTTGGCCACTGAGTCCAACCTGAAGACAAAAGCAGTA
ATTTTATCTCCAGAATCACATGGTTGTGAAGCGCCTACTGAGAAAAGAACTACAGCTATA
ATGCCTGT

Protein

922 aa

>Os12t0613200-01 Hypothetical conserved gene.
MPHSRSDSGSGSRGADPCRGRKRGRLLMLEEEEEEEESGMEGCSAPACGDVRGDFVGWCS
DRHQVASCSGDQTQSASMFAAMQENACSIDSKGVVCPQSGLGYSAGQNGTHGGGGSMLHQ
NLEGCMYMNQLGQMCGPYPPEQLYDGLSTGFLHRDLAIYAVFGGKMANPVSLGSLKQFLS
QWSSDSVVATRDESVENKKMAPVNKLILPDNLSSEESCWMFEDAEGRRHGPHSLAELSYW
HHSSYLHDLSMIYHVDSKFGPFTLVSLIDWWSGGTEHSESSANDSGSLNALMDDVVEDIS
HQLHAGIMKSARKVFIDEIFSSVLPEMIACRKTEKQMAAKRKSQAAKTDNVSNKNALVLK
GKGDGTSTRPKSLNSYNNKVPEDPSVAVQSTAMQYEFADILSAVWETIYNKSMKSIWDEV
LYDPVMDYCDAWLKRKNESNLLSTVVPGASDNQKMQDTDEMSPKAICDSDAPESDMDFPP
GFGPNQESAEHSHSACVEYVTEKTDGRSGSSITLFSGPLGRVQVMLANELYVAAKEALFQ
HFEEVISEEITNCLCIGFEDDINQERIRTPVHAPEPSSPPGISVHETPSPAEMPRDEISD
MAEMARDEISDMAVDTIPCPADMAASGTSTVPEVTTDKLIIPYVEHQSPSASHASIFEKL
DAHEEAELDDSFDEVPPGTEAGLASLVIMEKNKYQPSKSVDSVLDIYRYTSWAFFRQILH
ESVMKEWASLFSGALSNCFDSWYARKNIVAKTMDDTLRPKEYTYYRKRKLRKNCEASSSE
KPMDEQLSRPLRDLVECKVNMKNIHRSSKAGISQRVSVVEKPSKKRAKPSHNDNINLNIQ
QDLKLLSDKVPKRNRSSHPTSKPLVSSKVPTEDRTTSAMPAKKRKQKNLATESNLKTKAV
ILSPESHGCEAPTEKRTTAIMP

5'UTR

chr12:25975934..25976050 (- strand) : 117 bp

CDS

chr12:25975910..25975933 (- strand) : 24 bp

chr12:25975559..25975707 (- strand) : 149 bp

chr12:25974995..25975451 (- strand) : 457 bp

chr12:25974784..25974906 (- strand) : 123 bp

chr12:25973268..25973555 (- strand) : 288 bp

chr12:25972817..25973167 (- strand) : 351 bp

chr12:25972403..25972702 (- strand) : 300 bp

chr12:25972077..25972314 (- strand) : 238 bp

chr12:25971372..25971998 (- strand) : 627 bp

chr12:25971080..25971290 (- strand) : 211 bp

FASTA

>Os12t0613200-01 class=Sequence position=chr12:25971080..25976050 (- strand)
GAGAGAGAGA GAGAGGCTCA TCGCCAATCC GACCAACGCA ACCACTCCAA CCCACCGGCG GCGGCGGCGG CGGCGGTGGG
GCGCGGCGAC CCGGCACCAC GCGACCCCGG CGTCGCCATG CCGCACTCGC GCTCCGATTC GGTAAGCTCC CCCTCTCTCC
CCTCCCACAC TCTCCGGCCG GCTCGTCGTC GGCGTGTTAG AGATAGATTC TAGGGTTCAT CGGAGCTCTT AGATCCGCGG
GTTGATTGGT TCTTCACCCT AAGAAGAGGA GGAGGTGGAG GAGGAGGAGA TCTGCTGGTA CTGACGCGAT GATTTTGTTT
TTGCGGGTAT TGTCGGTGTT CAGGGGTCGG GTTCCCGCGG CGCTGACCCT TGCCGTGGGA GGAAGCGCGG GAGGCTGTTG
ATGCTCGAGG AGGAGGAGGA GGAGGAGGAG TCGGGGATGG AGGGGTGCTC GGCGCCAGCA TGCGGCGATG TGCGGGGGGA
TTTCGTTGGA TGGTACAGCC TTCACTGATC CTTTCCTTAT CTGATTCGTC ATCAGTTTTA CAGTTGATCG ACCGATATTT
TGGCCTTCGC CATCTCACAT GGTTGGTTGT GTTGCTCAGG TGTTCGGACC GGCATCAGGT GGCTTCCTGC AGCGGCGACC
AGACGCAAAG CGCCAGCATG TTTGCCGCGA TGCAGGAGAA CGCCTGCTCC ATCGATAGCA AAGGTGTGGT GTGTCCGCAG
TCCGGGCTAG GGTATTCAGC TGGCCAGAAC GGGACGCACG GTGGTGGCGG GTCTATGCTG CATCAGAATT TGGAAGGCTG
CATGTATATG AATCAGCTTG GGCAGATGTG CGGCCCTTAT CCACCTGAAC AACTGTACGA TGGATTATCC ACTGGTTTCT
TGCATCGAGA CCTTGCTATT TATGCCGTTT TTGGTGGGAA AATGGCCAAC CCTGTTTCCT TAGGTTCCCT GAAACAGTTT
CTTTCACAAT GGAGTTCTGA TTCTGTGGTC GCCACAAGAG ACGAATCGGT GGAGAATAAG AAAATGGCCC CTGTTAACAA
ATTGATTCTT CCTGATGTAT GGCTTTTATT TCTTTCCATA TTAGCACATC ATCCTCTTGC TTGTCTACCT TCCTTATTTG
TGTGATTCAT GTTCTCTCTG CCAGAATCTT TCAAGTGAAG AATCATGTTG GATGTTTGAG GACGCAGAAG GCCGCAGGCA
TGGGCCACAT TCTCTTGCTG AACTTTCTTA TTGGCATCAC AGTAGCTATC TACATGACCT TTCAATGGTA AGAAAAGCAT
CAGTCGAAAC CATGTGTTCT GGATCCACTC TTACGCTTTG CTTGCAAATG TTCTATTTTA TTGGACTGTT AATGTGATTA
ATGTGACGTG CATAGTGTTT TTAAACAAGT AATGAAATGG CTGTTGTAGA ATAAATTGAA GATATTGTTT CAATTTGGCC
CTAACTAACC ACTACATGTA GAATATCAGG CTGTTACAAT GCTCTTATGT ACTAGATGAT AAAATAGTAC AGGAGATTTT
TACGGTGCAC CAAATTAGAG TGCTGCTTGG TTTGGCTGTT TTTCTCCACA ATCCATTGAC ACTGCAACTT GATTAAGTTA
TAATTTATTT GGTTTGCGTA CACTAGTATT GGATACTGCA GTATACAATA CGGGCCCAAT ACAATCTCGT TACCACTGAA
TATCGAGTGC ATTTGGAAAG TGTTACTGCA AAAGCGATCG CCCACTCAAT CCAAACAATA TTTGTTATTC CTCATCCCGT
TTCCATTAGC TGTCAGCTTA ATTGGAAAAT GTTACGGTGT TTCAACCAAA CATCTATATT GAGCCATCCA TTCTATGAGA
TCTAATGGTT AGTATTACTA TTACTATCTA TAAGAGGTAA TAAAGAGTAT TACTATTACC ATCTATAAGA GGTAATAAAG
ACTTTCTGAC CGCACCATAA ATAATGAAAT ACATGTAATC TTTAGCTGGT GGAATCATTT AAGTGATGGA TAATAAATGT
TGGTTTAACT TTTATGATTC AATTTAATTA TTTGACATTT AGGACTAGAT TCGATTTGTT GTCTTCTTTT TTTTAAAAAA
ACCTCTTGAA ACATAATTCA TTTATTGGTT TTGGTAGATA GCATCACAAA AAGAATATTT GATGTGATTG TTCTTATACA
TATTGTGATT GTTCTTATAC ATATCTTTTT CCCTCCTGGT GGAGGAATTT TTTTAAGGTA TCTCAATTAA GTTGGAATAA
ATCAATAAAT TAATAGGCTA TGTGCTGTAT GGAAATCATT TAGGTTCACC CAACTTATGG GTAAAGGCTA ATATATGATT
ATGGTGGAAC TTCTGTTGGT TAGGTTTTTT TGAGTATCTT CTTGTAACAG GATGACAGAT CAGTTATAAC GTGTTATGTA
CACAGCTCCC CCAATTCCAG TGGATTTACA TTTGTGAATT ATTCTTGGTT CACACTAGTA CATGATCTGA ACAATAACAC
TTCTTTTTTT AACAGATTTA CCATGTTGAT AGCAAGTTTG GCCCATTTAC ACTTGTATCA CTAATTGATT GGTGGAGTGG
AGGCACAGAG CATTCAGAAT CTTCAGCCAA TGATTCTGGG TCACTGAACG CTTTAATGGA TGATGTAGTT GAAGATATCA
GCCATCAGCT GCATGCTGGA ATTATGAAAT CAGCCCGCAA AGTTTTTATT GATGAAATAT TTAGCAGCGT ACTTCCAGAA
ATGATTGCTT GCAGGAAGAC AGAGAAGCAA ATGGCTGCAA AACGTAAGAG CCAAGCTGCT AAGGTGTGTT TTATCTGTCA
TGGTTTTTGG GACATGAACT TCTTTTGTAT TACCTACCCA TTTGCAAATT TTAATCCTGT CCAAGATGGT TTTATTTTTC
CAGACTGACA ATGTGAGTAA CAAGAATGCT TTGGTACTTA AGGGCAAGGG TGATGGAACA TCTACTCGTC CAAAAAGCCT
AAACTCGTAT AATAATAAAG TACCGGAAGA TCCTTCTGTG GCTGTTCAAT CAACTGCAAT GCAGTATGAA TTTGCTGATA
TATTATCGGC AGTTTGGGAA ACAATTTATA ACAAATCCAT GAAGAGTATC TGGGATGAAG TACTGTATGA TCCTGTCATG
GACTACTGTG ATGCATGGCT TAAAAGAAAA AATGAGTCGA ATCTTCTCTC TACAGTTGTT CCTGGAGCCT CTGATAACCA
AAAGATGCAA GACACAGATG AAATGTCACC AAAGGTTTCT CCAATAGGAC TAAACACATT TCTTTCTTTG AAAGATGGGT
TTAACATTTA AGATGTAAAT CCTTCTTTCG CTGCAGATAT GATTTTCTGA CAGTTTCATG GTTTGCAGGC AATTTGTGAT
TCAGATGCTC CTGAAAGTGA CATGGATTTC CCTCCAGGAT TTGGACCAAA TCAGGAATCT GCTGAGCATT CCCACTCTGC
GTGTGTTGAG TATGTTACTG AAAAAACAGA TGGGAGGTCT GGATCAAGTA TCACGTTGTT TTCTGGCCCC TTAGGACGAG
TTCAGGTAAT GCTGGCAAAT GAACTATATG TGGCAGCAAA GGAAGCTTTG TTCCAGCATT TTGAGGAGGT CATTTCAGAG
GAGATAACAA ACTGTTTGTG CATTGGATTT GAAGATGATA TTAATCAAGT GAGATGACAA TAATAACTAC TTTTTATTGA
TAGCTGTTAA TATTTCAGAA TTTGCATGAT TTTTACATCT AAGTGTTGTA TTGCAGGAAC GAATTCGTAC GCCTGTTCAC
GCACCAGAAC CATCCAGTCC TCCTGGAATA TCTGTGCATG AAACGCCCAG TCCTGCTGAA ATGCCTCGAG ATGAAATTTC
GGATATGGCT GAAATGGCTC GAGATGAAAT TTCAGATATG GCTGTAGATA CAATACCCTG CCCTGCTGAT ATGGCGGCAT
CTGGAACATC AACTGTTCCT GAAGTGACAA CAGACAAACT GATCATTCCT TACGGTAAAT GAATAACATC TTCTGTTGCA
TTGCCTTACC TGAGCAACAT TAAATTATTC TAATTCCTTA ATTTGGATGC AGTGGAACAT CAATCGCCCT CTGCATCTCA
TGCAAGTATA TTTGAAAAGT TGGATGCACA TGAAGAAGCT GAATTGGATG ACAGTTTTGA TGAGGTGCCT CCTGGAACAG
AGGCTGGCTT AGCTTCATTG GTGATTATGG AGAAAAACAA ATACCAGCCC TCAAAATCAG TAGACTCAGT GCTTGACATT
TATAGATATA CTAGTTGGGC ATTCTTCAGG CAAATACTGC ATGAGAGTGT AATGAAAGAG TGGGCATCTC TCTTCTCAGG
TGCTCTCAGC AATTGTTTTG ACTCATGGTA TGCCAGGAAA AATATTGTGG CTAAAACCAT GGATGATACA TTGAGACCCA
AAGAATATAC TTACTACAGG AAGAGGAAAC TGAGGAAAAA CTGTGAAGCA TCATCATCAG AAAAACCAAT GGATGAGCAG
CTCTCCAGAC CTCTTCGTGA TCTTGTTGAA TGCAAGGTTA ATATGAAAAA TATCCATCGA TCAAGCAAGG CTGGGATTTC
GCAGAGAGTT TCTGTTGTGG AGAAGCCCTC CAAAAAGCGT GCCAAACCTT CACATAATGA TAATATTAAT CTGAATATCC
AGCAGGACTT GAAACTCCTT TCCGACAAGG TGCCAAAGAG TGAGTCATTC AGTCCTCATC TCCATCTCCT TTTTAATATA
AATACATTTC ACAGAGTTAA CATTCATCTT TCGTTGCCAG GAAACAGGTC TTCCCATCCT ACCAGTAAGC CTCTTGTTAG
TAGCAAAGTG CCTACTGAGG ATAGAACTAC ATCAGCAATG CCTGCAAAGA AAAGAAAGCA GAAAAACTTG GCCACTGAGT
CCAACCTGAA GACAAAAGCA GTAATTTTAT CTCCAGAATC ACATGGTTGT GAAGCGCCTA CTGAGAAAAG AACTACAGCT
ATAATGCCTG T

Locus: Os12g0613200

Loading...

Locus: Os12g0613200

Loading...