Os12t0613200-02

Locus

Os12g0613200

Description

Similar to Histone-lysine N-methyltransferase, H3 lysine-4 specific SET1 (EC 2.1.1.43) (Set1/Ash2 histone methyltransferase complex subunit SET1) (SET-domain-containing protein 1).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET43, SDG717

Oryzabase Gene Name Synonym(s)

SET protein 43

Transcript Evidence

AK068250 (DDBJ, Best hit)

Protein Evidence

B9GE94 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

SET domain (IPR001214)

GYF (IPR003169)

Post-SET domain (IPR003616)

Full-length cDNA

J013139B12 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0613200-02)

RiceXPro (AK068250)

Others

Oryzabase (13406)

KEGG (Os12t0613200-02 (EC:2.1.1.43))

Transcript

4238 bp

>Os12t0613200-02 Similar to Histone-lysine N-methyltransferase, H3 lysine-4 specific SET1 (EC 2.1.1.43) (Set1/Ash2 histone methyltransferase complex subunit SET1) (SET-domain-containing protein 1).
GAGAGAGAGAGAGGCTCATCGCCAATCCGACCAACGCAACCACTCCAACCCACCGGCGGC
GGCGGCGGCGGCGGTGGGGCGCGGCGACCCGGCACCACGCGACCCCGGCGTCGCCATGCC
GCACTCGCGCTCCGATTCGGGGTCGGGTTCCCGCGGCGCTGACCCTTGCCGTGGGAGGAA
GCGCGGGAGGCTGTTGATGCTCGAGGAGGAGGAGGAGGAGGAGGAGTCGGGGATGGAGGG
GTGCTCGGCGCCAGCATGCGGCGATGTGCGGGGGGATTTCGTTGGATGGTGTTCGGACCG
GCATCAGGTGGCTTCCTGCAGCGGCGACCAGACGCAAAGCGCCAGCATGTTTGCCGCGAT
GCAGGAGAACGCCTGCTCCATCGATAGCAAAGGTGTGGTGTGTCCGCAGTCCGGGCTAGG
GTATTCAGCTGGCCAGAACGGGACGCACGGTGGTGGCGGGTCTATGCTGCATCAGAATTT
GGAAGGCTGCATGTATATGAATCAGCTTGGGCAGATGTGCGGCCCTTATCCACCTGAACA
ACTGTACGATGGATTATCCACTGGTTTCTTGCATCGAGACCTTGCTATTTATGCCGTTTT
TGGTGGGAAAATGGCCAACCCTGTTTCCTTAGGTTCCCTGAAACAGTTTCTTTCACAATG
GAGTTCTGATTCTGTGGTCGCCACAAGAGACGAATCGGTGGAGAATAAGAAAATGGCCCC
TGTTAACAAATTGATTCTTCCTGATAATCTTTCAAGTGAAGAATCATGTTGGATGTTTGA
GGACGCAGAAGGCCGCAGGCATGGGCCACATTCTCTTGCTGAACTTTCTTATTGGCATCA
CAGTAGCTATCTACATGACCTTTCAATGATTTACCATGTTGATAGCAAGTTTGGCCCATT
TACACTTGTATCACTAATTGATTGGTGGAGTGGAGGCACAGAGCATTCAGAATCTTCAGC
CAATGATTCTGGGTCACTGAACGCTTTAATGGATGATGTAGTTGAAGATATCAGCCATCA
GCTGCATGCTGGAATTATGAAATCAGCCCGCAAAGTTTTTATTGATGAAATATTTAGCAG
CGTACTTCCAGAAATGATTGCTTGCAGGAAGACAGAGAAGCAAATGGCTGCAAAACGTAA
GAGCCAAGCTGCTAAGACTGACAATGTGAGTAACAAGAATGCTTTGGTACTTAAGGGCAA
GGGTGATGGAACATCTACTCGTCCAAAAAGCCTAAACTCGTATAATAATAAAGTACCGGA
AGATCCTTCTGTGGCTGTTCAATCAACTGCAATGCAGTATGAATTTGCTGATATATTATC
GGCAGTTTGGGAAACAATTTATAACAAATCCATGAAGAGTATCTGGGATGAAGTACTGTA
TGATCCTGTCATGGACTACTGTGATGCATGGCTTAAAAGAAAAAATGAGTCGAATCTTCT
CTCTACAGTTGTTCCTGGAGCCTCTGATAACCAAAAGATGCAAGACACAGATGAAATGTC
ACCAAAGGCAATTTGTGATTCAGATGCTCCTGAAAGTGACATGGATTTCCCTCCAGGATT
TGGACCAAATCAGGAATCTGCTGAGCATTCCCACTCTGCGTGTGTTGAGTATGTTACTGA
AAAAACAGATGGGAGGTCTGGATCAAGTATCACGTTGTTTTCTGGCCCCTTAGGACGAGT
TCAGGTAATGCTGGCAAATGAACTATATGTGGCAGCAAAGGAAGCTTTGTTCCAGCATTT
TGAGGAGGTCATTTCAGAGGAGATAACAAACTGTTTGTGCATTGGATTTGAAGATGATAT
TAATCAAGAACGAATTCGTACGCCTGTTCACGCACCAGAACCATCCAGTCCTCCTGGAAT
ATCTGTGCATGAAACGCCCAGTCCTGCTGAAATGCCTCGAGATGAAATTTCGGATATGGC
TGAAATGGCTCGAGATGAAATTTCAGATATGGCTGTAGATACAATACCCTGCCCTGCTGA
TATGGCGGCATCTGGAACATCAACTGTTCCTGAAGTGACAACAGACAAACTGATCATTCC
TTACGTGGAACATCAATCGCCCTCTGCATCTCATGCAAGTATATTTGAAAAGTTGGATGC
ACATGAAGAAGCTGAATTGGATGACAGTTTTGATGAGGTGCCTCCTGGAACAGAGGCTGG
CTTAGCTTCATTGGTGATTATGGAGAAAAACAAATACCAGCCCTCAAAATCAGTAGACTC
AGTGCTTGACATTTATAGATATACTAGTTGGGCATTCTTCAGGCAAATACTGCATGAGAG
TGTAATGAAAGAGTGGGCATCTCTCTTCTCAGGTGCTCTCAGCAATTGTTTTGACTCATG
GTATGCCAGGAAAAATATTGTGGCTAAAACCATGGATGATACATTGAGACCCAAAGAATA
TACTTACTACAGGAAGAGGAAACTGAGGAAAAACTGTGAAGCATCATCATCAGAAAAACC
AATGGATGAGCAGCTCTCCAGACCTCTTCGTGATCTTGTTGAATGCAAGGTTAATATGAA
AAATATCCATCGATCAAGCAAGGCTGGGATTTCGCAGAGAGTTTCTGTTGTGGAGAAGCC
CTCCAAAAAGCGTGCCAAACCTTCACATAATGATAATATTAATCTGAATATCCAGCAGGA
CTTGAAACTCCTTTCCGACAAGGTGCCAAAGAGAAACAGGTCTTCCCATCCTACCAGTAA
GCCTCTTGTTAGTAGCAAAGTGCCTACTGAGGATAGAACTACATCAGCAATGCCTGCAAA
GAAAAGAAAGCAGAAAAACTTGGCCACTGAGTCCAACCTGAAGACAAAAGCAGTAATTTT
ATCTCCAGAATCACATGGTTGTGAAGCGCCTACTGAGAAAAGAACTACAGCTATAATGCC
TGTAAACAAAAGAAAGAAAAACTTGTCTGGTGAATCCAAACTGAAGGCAAAACCGTTAAC
AAGTCCAGAATCGTATGTTTGTGAAGCTCCTATTGACAATAGAACTACATCTACAATGCC
TGCGAAGAAAAGAAAGCAGAAAAACTTGTCCAATGAGTCCAACCTGAAGAAAAAACCGTT
GGTTTTATGTCCTGAATCATATGGTTGTGCAAGAGCTTCTGTGAGTGGATGGGAATGGCG
TGATTGGGCACGCAATGCCACTCCATCAGAAAGAGCTCAAGTGAGAGGCTACCGAGTGAG
GAGTATTCTCTCAGCTCCAGAAAATAATGTATTGAAAAGTTCACAAGTTAAGGGCTCATC
TGCAAGAACAAACCGGGTTAAGCTACGGAATCTGTTAGCAGCCGCTGAAGGCACTGACCT
ACTAAAAATTATGCAATCGAAGTCAAGGAAGAAGCGGCTACGTTTTCAAAGGAGTAAGAT
CCATGAATGGGGTCTGGTGGCTCTTGAGTCTATTGATGCAGAAGATTTTGTAATTGAATA
TGTTGGTGAGCTGATCCGCCGACAGGTCTCGGACATACGCGAGGATCAATACGAGAAAAG
TGGAATTGGAAGCAGTTACCTTTTCCGTTTGGACGATGACTATGTGGTTGATGCTACTAA
GCGTGGTGGGTTAGCAAGATTCATCAACCATTCTTGTGATCCAAATTGCTATACAAAAGT
AATTACTGTCGAGGGCCAGAAGAAGATTGTCATTTATGCAAAGAGGCGTATATATGCTGG
CGAGGAACTGACTTATAATTATAAATTTCCACTGGAGGAAAAAAAGATTCCATGCCATTG
TGGTTCCCAGAGGTGCCGCGGATCAATGAATTAGGAAGTAAAGTTTATAAGTCAGGAGGT
AACTGCAATTGGGTGCTACCCCAGTATGTATGTGTCATGCGTGCTTGTCGATTGTACTGG
GCAGAAGTTCACTGCAGAAATGTTCTTGGATTTACTGACAGGATGGTAATTGTGTAGCAA
GGTTAGATGGACTAATTCGGGCTATCCAGAGGAAGGTAAAGCGCTCAAGTGTGGACTGAT
GGACTTGTTGGTTGCCTTAGTGTGTCTCCTGAACGAGGTTCATGTTTACTTGCTGACAAG
GTACATGGATACATTTAATCTATCATCCGTGGTGTATGTGTATGTATTTCGTCCAGAAAA
AAAAAAGCATCCGAATCATGTGGTCAGGTGGATACAGACGTGCATGAATATCTGATATCA
CAATCGTAAGTATGAATTCAAGTATTTTACCAGCTTATATGTACTTTGTGCAGGCTAACA
ACAGGGCAAAAGCAAGCCACTAACAACCAACCCGTTCC

CDS

3639 bp

>Os12t0613200-02 Similar to Histone-lysine N-methyltransferase, H3 lysine-4 specific SET1 (EC 2.1.1.43) (Set1/Ash2 histone methyltransferase complex subunit SET1) (SET-domain-containing protein 1).
ATGCCGCACTCGCGCTCCGATTCGGGGTCGGGTTCCCGCGGCGCTGACCCTTGCCGTGGG
AGGAAGCGCGGGAGGCTGTTGATGCTCGAGGAGGAGGAGGAGGAGGAGGAGTCGGGGATG
GAGGGGTGCTCGGCGCCAGCATGCGGCGATGTGCGGGGGGATTTCGTTGGATGGTGTTCG
GACCGGCATCAGGTGGCTTCCTGCAGCGGCGACCAGACGCAAAGCGCCAGCATGTTTGCC
GCGATGCAGGAGAACGCCTGCTCCATCGATAGCAAAGGTGTGGTGTGTCCGCAGTCCGGG
CTAGGGTATTCAGCTGGCCAGAACGGGACGCACGGTGGTGGCGGGTCTATGCTGCATCAG
AATTTGGAAGGCTGCATGTATATGAATCAGCTTGGGCAGATGTGCGGCCCTTATCCACCT
GAACAACTGTACGATGGATTATCCACTGGTTTCTTGCATCGAGACCTTGCTATTTATGCC
GTTTTTGGTGGGAAAATGGCCAACCCTGTTTCCTTAGGTTCCCTGAAACAGTTTCTTTCA
CAATGGAGTTCTGATTCTGTGGTCGCCACAAGAGACGAATCGGTGGAGAATAAGAAAATG
GCCCCTGTTAACAAATTGATTCTTCCTGATAATCTTTCAAGTGAAGAATCATGTTGGATG
TTTGAGGACGCAGAAGGCCGCAGGCATGGGCCACATTCTCTTGCTGAACTTTCTTATTGG
CATCACAGTAGCTATCTACATGACCTTTCAATGATTTACCATGTTGATAGCAAGTTTGGC
CCATTTACACTTGTATCACTAATTGATTGGTGGAGTGGAGGCACAGAGCATTCAGAATCT
TCAGCCAATGATTCTGGGTCACTGAACGCTTTAATGGATGATGTAGTTGAAGATATCAGC
CATCAGCTGCATGCTGGAATTATGAAATCAGCCCGCAAAGTTTTTATTGATGAAATATTT
AGCAGCGTACTTCCAGAAATGATTGCTTGCAGGAAGACAGAGAAGCAAATGGCTGCAAAA
CGTAAGAGCCAAGCTGCTAAGACTGACAATGTGAGTAACAAGAATGCTTTGGTACTTAAG
GGCAAGGGTGATGGAACATCTACTCGTCCAAAAAGCCTAAACTCGTATAATAATAAAGTA
CCGGAAGATCCTTCTGTGGCTGTTCAATCAACTGCAATGCAGTATGAATTTGCTGATATA
TTATCGGCAGTTTGGGAAACAATTTATAACAAATCCATGAAGAGTATCTGGGATGAAGTA
CTGTATGATCCTGTCATGGACTACTGTGATGCATGGCTTAAAAGAAAAAATGAGTCGAAT
CTTCTCTCTACAGTTGTTCCTGGAGCCTCTGATAACCAAAAGATGCAAGACACAGATGAA
ATGTCACCAAAGGCAATTTGTGATTCAGATGCTCCTGAAAGTGACATGGATTTCCCTCCA
GGATTTGGACCAAATCAGGAATCTGCTGAGCATTCCCACTCTGCGTGTGTTGAGTATGTT
ACTGAAAAAACAGATGGGAGGTCTGGATCAAGTATCACGTTGTTTTCTGGCCCCTTAGGA
CGAGTTCAGGTAATGCTGGCAAATGAACTATATGTGGCAGCAAAGGAAGCTTTGTTCCAG
CATTTTGAGGAGGTCATTTCAGAGGAGATAACAAACTGTTTGTGCATTGGATTTGAAGAT
GATATTAATCAAGAACGAATTCGTACGCCTGTTCACGCACCAGAACCATCCAGTCCTCCT
GGAATATCTGTGCATGAAACGCCCAGTCCTGCTGAAATGCCTCGAGATGAAATTTCGGAT
ATGGCTGAAATGGCTCGAGATGAAATTTCAGATATGGCTGTAGATACAATACCCTGCCCT
GCTGATATGGCGGCATCTGGAACATCAACTGTTCCTGAAGTGACAACAGACAAACTGATC
ATTCCTTACGTGGAACATCAATCGCCCTCTGCATCTCATGCAAGTATATTTGAAAAGTTG
GATGCACATGAAGAAGCTGAATTGGATGACAGTTTTGATGAGGTGCCTCCTGGAACAGAG
GCTGGCTTAGCTTCATTGGTGATTATGGAGAAAAACAAATACCAGCCCTCAAAATCAGTA
GACTCAGTGCTTGACATTTATAGATATACTAGTTGGGCATTCTTCAGGCAAATACTGCAT
GAGAGTGTAATGAAAGAGTGGGCATCTCTCTTCTCAGGTGCTCTCAGCAATTGTTTTGAC
TCATGGTATGCCAGGAAAAATATTGTGGCTAAAACCATGGATGATACATTGAGACCCAAA
GAATATACTTACTACAGGAAGAGGAAACTGAGGAAAAACTGTGAAGCATCATCATCAGAA
AAACCAATGGATGAGCAGCTCTCCAGACCTCTTCGTGATCTTGTTGAATGCAAGGTTAAT
ATGAAAAATATCCATCGATCAAGCAAGGCTGGGATTTCGCAGAGAGTTTCTGTTGTGGAG
AAGCCCTCCAAAAAGCGTGCCAAACCTTCACATAATGATAATATTAATCTGAATATCCAG
CAGGACTTGAAACTCCTTTCCGACAAGGTGCCAAAGAGAAACAGGTCTTCCCATCCTACC
AGTAAGCCTCTTGTTAGTAGCAAAGTGCCTACTGAGGATAGAACTACATCAGCAATGCCT
GCAAAGAAAAGAAAGCAGAAAAACTTGGCCACTGAGTCCAACCTGAAGACAAAAGCAGTA
ATTTTATCTCCAGAATCACATGGTTGTGAAGCGCCTACTGAGAAAAGAACTACAGCTATA
ATGCCTGTAAACAAAAGAAAGAAAAACTTGTCTGGTGAATCCAAACTGAAGGCAAAACCG
TTAACAAGTCCAGAATCGTATGTTTGTGAAGCTCCTATTGACAATAGAACTACATCTACA
ATGCCTGCGAAGAAAAGAAAGCAGAAAAACTTGTCCAATGAGTCCAACCTGAAGAAAAAA
CCGTTGGTTTTATGTCCTGAATCATATGGTTGTGCAAGAGCTTCTGTGAGTGGATGGGAA
TGGCGTGATTGGGCACGCAATGCCACTCCATCAGAAAGAGCTCAAGTGAGAGGCTACCGA
GTGAGGAGTATTCTCTCAGCTCCAGAAAATAATGTATTGAAAAGTTCACAAGTTAAGGGC
TCATCTGCAAGAACAAACCGGGTTAAGCTACGGAATCTGTTAGCAGCCGCTGAAGGCACT
GACCTACTAAAAATTATGCAATCGAAGTCAAGGAAGAAGCGGCTACGTTTTCAAAGGAGT
AAGATCCATGAATGGGGTCTGGTGGCTCTTGAGTCTATTGATGCAGAAGATTTTGTAATT
GAATATGTTGGTGAGCTGATCCGCCGACAGGTCTCGGACATACGCGAGGATCAATACGAG
AAAAGTGGAATTGGAAGCAGTTACCTTTTCCGTTTGGACGATGACTATGTGGTTGATGCT
ACTAAGCGTGGTGGGTTAGCAAGATTCATCAACCATTCTTGTGATCCAAATTGCTATACA
AAAGTAATTACTGTCGAGGGCCAGAAGAAGATTGTCATTTATGCAAAGAGGCGTATATAT
GCTGGCGAGGAACTGACTTATAATTATAAATTTCCACTGGAGGAAAAAAAGATTCCATGC
CATTGTGGTTCCCAGAGGTGCCGCGGATCAATGAATTAG

Protein

1213 aa

>Os12t0613200-02 Similar to Histone-lysine N-methyltransferase, H3 lysine-4 specific SET1 (EC 2.1.1.43) (Set1/Ash2 histone methyltransferase complex subunit SET1) (SET-domain-containing protein 1).
MPHSRSDSGSGSRGADPCRGRKRGRLLMLEEEEEEEESGMEGCSAPACGDVRGDFVGWCS
DRHQVASCSGDQTQSASMFAAMQENACSIDSKGVVCPQSGLGYSAGQNGTHGGGGSMLHQ
NLEGCMYMNQLGQMCGPYPPEQLYDGLSTGFLHRDLAIYAVFGGKMANPVSLGSLKQFLS
QWSSDSVVATRDESVENKKMAPVNKLILPDNLSSEESCWMFEDAEGRRHGPHSLAELSYW
HHSSYLHDLSMIYHVDSKFGPFTLVSLIDWWSGGTEHSESSANDSGSLNALMDDVVEDIS
HQLHAGIMKSARKVFIDEIFSSVLPEMIACRKTEKQMAAKRKSQAAKTDNVSNKNALVLK
GKGDGTSTRPKSLNSYNNKVPEDPSVAVQSTAMQYEFADILSAVWETIYNKSMKSIWDEV
LYDPVMDYCDAWLKRKNESNLLSTVVPGASDNQKMQDTDEMSPKAICDSDAPESDMDFPP
GFGPNQESAEHSHSACVEYVTEKTDGRSGSSITLFSGPLGRVQVMLANELYVAAKEALFQ
HFEEVISEEITNCLCIGFEDDINQERIRTPVHAPEPSSPPGISVHETPSPAEMPRDEISD
MAEMARDEISDMAVDTIPCPADMAASGTSTVPEVTTDKLIIPYVEHQSPSASHASIFEKL
DAHEEAELDDSFDEVPPGTEAGLASLVIMEKNKYQPSKSVDSVLDIYRYTSWAFFRQILH
ESVMKEWASLFSGALSNCFDSWYARKNIVAKTMDDTLRPKEYTYYRKRKLRKNCEASSSE
KPMDEQLSRPLRDLVECKVNMKNIHRSSKAGISQRVSVVEKPSKKRAKPSHNDNINLNIQ
QDLKLLSDKVPKRNRSSHPTSKPLVSSKVPTEDRTTSAMPAKKRKQKNLATESNLKTKAV
ILSPESHGCEAPTEKRTTAIMPVNKRKKNLSGESKLKAKPLTSPESYVCEAPIDNRTTST
MPAKKRKQKNLSNESNLKKKPLVLCPESYGCARASVSGWEWRDWARNATPSERAQVRGYR
VRSILSAPENNVLKSSQVKGSSARTNRVKLRNLLAAAEGTDLLKIMQSKSRKKRLRFQRS
KIHEWGLVALESIDAEDFVIEYVGELIRRQVSDIREDQYEKSGIGSSYLFRLDDDYVVDA
TKRGGLARFINHSCDPNCYTKVITVEGQKKIVIYAKRRIYAGEELTYNYKFPLEEKKIPC
HCGSQRCRGSMN*

5'UTR

chr12:25975934..25976048 (- strand) : 115 bp

CDS

chr12:25975910..25975933 (- strand) : 24 bp

chr12:25975559..25975707 (- strand) : 149 bp

chr12:25974995..25975451 (- strand) : 457 bp

chr12:25974784..25974906 (- strand) : 123 bp

chr12:25973268..25973555 (- strand) : 288 bp

chr12:25972817..25973167 (- strand) : 351 bp

chr12:25972403..25972702 (- strand) : 300 bp

chr12:25972077..25972314 (- strand) : 238 bp

chr12:25971372..25971998 (- strand) : 627 bp

chr12:25970641..25971290 (- strand) : 650 bp

chr12:25970441..25970563 (- strand) : 123 bp

chr12:25970275..25970355 (- strand) : 81 bp

chr12:25969970..25970023 (- strand) : 54 bp

chr12:25969744..25969895 (- strand) : 152 bp

chr12:25969241..25969262 (- strand) : 22 bp

3'UTR

chr12:25969220..25969240 (- strand) : 21 bp

chr12:25968833..25968938 (- strand) : 106 bp

chr12:25967862..25967881 (- strand) : 20 bp

chr12:25967651..25967769 (- strand) : 119 bp

chr12:25966949..25967030 (- strand) : 82 bp

chr12:25966692..25966827 (- strand) : 136 bp

FASTA

>Os12t0613200-02 class=Sequence position=chr12:25966692..25976048 (- strand)
GAGAGAGAGA GAGGCTCATC GCCAATCCGA CCAACGCAAC CACTCCAACC CACCGGCGGC GGCGGCGGCG GCGGTGGGGC
GCGGCGACCC GGCACCACGC GACCCCGGCG TCGCCATGCC GCACTCGCGC TCCGATTCGG TAAGCTCCCC CTCTCTCCCC
TCCCACACTC TCCGGCCGGC TCGTCGTCGG CGTGTTAGAG ATAGATTCTA GGGTTCATCG GAGCTCTTAG ATCCGCGGGT
TGATTGGTTC TTCACCCTAA GAAGAGGAGG AGGTGGAGGA GGAGGAGATC TGCTGGTACT GACGCGATGA TTTTGTTTTT
GCGGGTATTG TCGGTGTTCA GGGGTCGGGT TCCCGCGGCG CTGACCCTTG CCGTGGGAGG AAGCGCGGGA GGCTGTTGAT
GCTCGAGGAG GAGGAGGAGG AGGAGGAGTC GGGGATGGAG GGGTGCTCGG CGCCAGCATG CGGCGATGTG CGGGGGGATT
TCGTTGGATG GTACAGCCTT CACTGATCCT TTCCTTATCT GATTCGTCAT CAGTTTTACA GTTGATCGAC CGATATTTTG
GCCTTCGCCA TCTCACATGG TTGGTTGTGT TGCTCAGGTG TTCGGACCGG CATCAGGTGG CTTCCTGCAG CGGCGACCAG
ACGCAAAGCG CCAGCATGTT TGCCGCGATG CAGGAGAACG CCTGCTCCAT CGATAGCAAA GGTGTGGTGT GTCCGCAGTC
CGGGCTAGGG TATTCAGCTG GCCAGAACGG GACGCACGGT GGTGGCGGGT CTATGCTGCA TCAGAATTTG GAAGGCTGCA
TGTATATGAA TCAGCTTGGG CAGATGTGCG GCCCTTATCC ACCTGAACAA CTGTACGATG GATTATCCAC TGGTTTCTTG
CATCGAGACC TTGCTATTTA TGCCGTTTTT GGTGGGAAAA TGGCCAACCC TGTTTCCTTA GGTTCCCTGA AACAGTTTCT
TTCACAATGG AGTTCTGATT CTGTGGTCGC CACAAGAGAC GAATCGGTGG AGAATAAGAA AATGGCCCCT GTTAACAAAT
TGATTCTTCC TGATGTATGG CTTTTATTTC TTTCCATATT AGCACATCAT CCTCTTGCTT GTCTACCTTC CTTATTTGTG
TGATTCATGT TCTCTCTGCC AGAATCTTTC AAGTGAAGAA TCATGTTGGA TGTTTGAGGA CGCAGAAGGC CGCAGGCATG
GGCCACATTC TCTTGCTGAA CTTTCTTATT GGCATCACAG TAGCTATCTA CATGACCTTT CAATGGTAAG AAAAGCATCA
GTCGAAACCA TGTGTTCTGG ATCCACTCTT ACGCTTTGCT TGCAAATGTT CTATTTTATT GGACTGTTAA TGTGATTAAT
GTGACGTGCA TAGTGTTTTT AAACAAGTAA TGAAATGGCT GTTGTAGAAT AAATTGAAGA TATTGTTTCA ATTTGGCCCT
AACTAACCAC TACATGTAGA ATATCAGGCT GTTACAATGC TCTTATGTAC TAGATGATAA AATAGTACAG GAGATTTTTA
CGGTGCACCA AATTAGAGTG CTGCTTGGTT TGGCTGTTTT TCTCCACAAT CCATTGACAC TGCAACTTGA TTAAGTTATA
ATTTATTTGG TTTGCGTACA CTAGTATTGG ATACTGCAGT ATACAATACG GGCCCAATAC AATCTCGTTA CCACTGAATA
TCGAGTGCAT TTGGAAAGTG TTACTGCAAA AGCGATCGCC CACTCAATCC AAACAATATT TGTTATTCCT CATCCCGTTT
CCATTAGCTG TCAGCTTAAT TGGAAAATGT TACGGTGTTT CAACCAAACA TCTATATTGA GCCATCCATT CTATGAGATC
TAATGGTTAG TATTACTATT ACTATCTATA AGAGGTAATA AAGAGTATTA CTATTACCAT CTATAAGAGG TAATAAAGAC
TTTCTGACCG CACCATAAAT AATGAAATAC ATGTAATCTT TAGCTGGTGG AATCATTTAA GTGATGGATA ATAAATGTTG
GTTTAACTTT TATGATTCAA TTTAATTATT TGACATTTAG GACTAGATTC GATTTGTTGT CTTCTTTTTT TTAAAAAAAC
CTCTTGAAAC ATAATTCATT TATTGGTTTT GGTAGATAGC ATCACAAAAA GAATATTTGA TGTGATTGTT CTTATACATA
TTGTGATTGT TCTTATACAT ATCTTTTTCC CTCCTGGTGG AGGAATTTTT TTAAGGTATC TCAATTAAGT TGGAATAAAT
CAATAAATTA ATAGGCTATG TGCTGTATGG AAATCATTTA GGTTCACCCA ACTTATGGGT AAAGGCTAAT ATATGATTAT
GGTGGAACTT CTGTTGGTTA GGTTTTTTTG AGTATCTTCT TGTAACAGGA TGACAGATCA GTTATAACGT GTTATGTACA
CAGCTCCCCC AATTCCAGTG GATTTACATT TGTGAATTAT TCTTGGTTCA CACTAGTACA TGATCTGAAC AATAACACTT
CTTTTTTTAA CAGATTTACC ATGTTGATAG CAAGTTTGGC CCATTTACAC TTGTATCACT AATTGATTGG TGGAGTGGAG
GCACAGAGCA TTCAGAATCT TCAGCCAATG ATTCTGGGTC ACTGAACGCT TTAATGGATG ATGTAGTTGA AGATATCAGC
CATCAGCTGC ATGCTGGAAT TATGAAATCA GCCCGCAAAG TTTTTATTGA TGAAATATTT AGCAGCGTAC TTCCAGAAAT
GATTGCTTGC AGGAAGACAG AGAAGCAAAT GGCTGCAAAA CGTAAGAGCC AAGCTGCTAA GGTGTGTTTT ATCTGTCATG
GTTTTTGGGA CATGAACTTC TTTTGTATTA CCTACCCATT TGCAAATTTT AATCCTGTCC AAGATGGTTT TATTTTTCCA
GACTGACAAT GTGAGTAACA AGAATGCTTT GGTACTTAAG GGCAAGGGTG ATGGAACATC TACTCGTCCA AAAAGCCTAA
ACTCGTATAA TAATAAAGTA CCGGAAGATC CTTCTGTGGC TGTTCAATCA ACTGCAATGC AGTATGAATT TGCTGATATA
TTATCGGCAG TTTGGGAAAC AATTTATAAC AAATCCATGA AGAGTATCTG GGATGAAGTA CTGTATGATC CTGTCATGGA
CTACTGTGAT GCATGGCTTA AAAGAAAAAA TGAGTCGAAT CTTCTCTCTA CAGTTGTTCC TGGAGCCTCT GATAACCAAA
AGATGCAAGA CACAGATGAA ATGTCACCAA AGGTTTCTCC AATAGGACTA AACACATTTC TTTCTTTGAA AGATGGGTTT
AACATTTAAG ATGTAAATCC TTCTTTCGCT GCAGATATGA TTTTCTGACA GTTTCATGGT TTGCAGGCAA TTTGTGATTC
AGATGCTCCT GAAAGTGACA TGGATTTCCC TCCAGGATTT GGACCAAATC AGGAATCTGC TGAGCATTCC CACTCTGCGT
GTGTTGAGTA TGTTACTGAA AAAACAGATG GGAGGTCTGG ATCAAGTATC ACGTTGTTTT CTGGCCCCTT AGGACGAGTT
CAGGTAATGC TGGCAAATGA ACTATATGTG GCAGCAAAGG AAGCTTTGTT CCAGCATTTT GAGGAGGTCA TTTCAGAGGA
GATAACAAAC TGTTTGTGCA TTGGATTTGA AGATGATATT AATCAAGTGA GATGACAATA ATAACTACTT TTTATTGATA
GCTGTTAATA TTTCAGAATT TGCATGATTT TTACATCTAA GTGTTGTATT GCAGGAACGA ATTCGTACGC CTGTTCACGC
ACCAGAACCA TCCAGTCCTC CTGGAATATC TGTGCATGAA ACGCCCAGTC CTGCTGAAAT GCCTCGAGAT GAAATTTCGG
ATATGGCTGA AATGGCTCGA GATGAAATTT CAGATATGGC TGTAGATACA ATACCCTGCC CTGCTGATAT GGCGGCATCT
GGAACATCAA CTGTTCCTGA AGTGACAACA GACAAACTGA TCATTCCTTA CGGTAAATGA ATAACATCTT CTGTTGCATT
GCCTTACCTG AGCAACATTA AATTATTCTA ATTCCTTAAT TTGGATGCAG TGGAACATCA ATCGCCCTCT GCATCTCATG
CAAGTATATT TGAAAAGTTG GATGCACATG AAGAAGCTGA ATTGGATGAC AGTTTTGATG AGGTGCCTCC TGGAACAGAG
GCTGGCTTAG CTTCATTGGT GATTATGGAG AAAAACAAAT ACCAGCCCTC AAAATCAGTA GACTCAGTGC TTGACATTTA
TAGATATACT AGTTGGGCAT TCTTCAGGCA AATACTGCAT GAGAGTGTAA TGAAAGAGTG GGCATCTCTC TTCTCAGGTG
CTCTCAGCAA TTGTTTTGAC TCATGGTATG CCAGGAAAAA TATTGTGGCT AAAACCATGG ATGATACATT GAGACCCAAA
GAATATACTT ACTACAGGAA GAGGAAACTG AGGAAAAACT GTGAAGCATC ATCATCAGAA AAACCAATGG ATGAGCAGCT
CTCCAGACCT CTTCGTGATC TTGTTGAATG CAAGGTTAAT ATGAAAAATA TCCATCGATC AAGCAAGGCT GGGATTTCGC
AGAGAGTTTC TGTTGTGGAG AAGCCCTCCA AAAAGCGTGC CAAACCTTCA CATAATGATA ATATTAATCT GAATATCCAG
CAGGACTTGA AACTCCTTTC CGACAAGGTG CCAAAGAGTG AGTCATTCAG TCCTCATCTC CATCTCCTTT TTAATATAAA
TACATTTCAC AGAGTTAACA TTCATCTTTC GTTGCCAGGA AACAGGTCTT CCCATCCTAC CAGTAAGCCT CTTGTTAGTA
GCAAAGTGCC TACTGAGGAT AGAACTACAT CAGCAATGCC TGCAAAGAAA AGAAAGCAGA AAAACTTGGC CACTGAGTCC
AACCTGAAGA CAAAAGCAGT AATTTTATCT CCAGAATCAC ATGGTTGTGA AGCGCCTACT GAGAAAAGAA CTACAGCTAT
AATGCCTGTA AACAAAAGAA AGAAAAACTT GTCTGGTGAA TCCAAACTGA AGGCAAAACC GTTAACAAGT CCAGAATCGT
ATGTTTGTGA AGCTCCTATT GACAATAGAA CTACATCTAC AATGCCTGCG AAGAAAAGAA AGCAGAAAAA CTTGTCCAAT
GAGTCCAACC TGAAGAAAAA ACCGTTGGTT TTATGTCCTG AATCATATGG TTGTGCAAGA GCTTCTGTGA GTGGATGGGA
ATGGCGTGAT TGGGCACGCA ATGCCACTCC ATCAGAAAGA GCTCAAGTGA GAGGCTACCG AGTGAGGAGT ATTCTCTCAG
CTCCAGAAAA TAATGTATTG AAAAGTTCAC AAGTTAAGGG CTCATCTGCA AGAACAAACC GGGTTAAGCT ACGGAATCTG
TTAGCAGCCG CTGAAGGCAC TGACCTACTA AAAATTATGC AATCGAAGGT AAAACAGTAT ATTTTATTTT GTCAAGTGCA
AATGTTTCTA TTCTGTGAAA TTTGAAATTT GAAAATGGTA TACAGTCAAG GAAGAAGCGG CTACGTTTTC AAAGGAGTAA
GATCCATGAA TGGGGTCTGG TGGCTCTTGA GTCTATTGAT GCAGAAGATT TTGTAATTGA ATATGTTGGT GAGCTGATCC
GCCGACAGGT AATTATGACT TAATGAACAA CGATCCCTTC ATTGATTTAC TGCATTTGAG CAACATGTTA TAAGATTGAT
TTATATCCCA CAGGTCTCGG ACATACGCGA GGATCAATAC GAGAAAAGTG GAATTGGAAG CAGTTACCTT TTCCGTTTGG
ACGATGACTA TGTGGTAGGT GTAGCCAGTT TCCTTCAACT ACATCCATCT AAGATGCTAT GTACATTTTT TTACTTCTTT
TTTATGTTCG CCTATTAGAC AACAGCAGAG TTAGTTGGTT TTTGTTTGTT TTGATGTATG GTCAGGATAG TTCTGTTGTT
TTGTAACCTC AACCTGTTCT ATATTGTGCT CTTTCTTTAC CAAATTTTAT GAGTGCACCT TGTGCTCTTC TGTATTAATT
GTGCCTATTT TCTTAATCTT TGAAGGTTGA TGCTACTAAG CGTGGTGGGT TAGCAAGATT CATCAACCAT TCTTGTGATG
TAAGCTGTTT AACATGAAAC TTTCAGTTGT GATGCTTATT CTATGCTAAA TGACGTCTTG TTTTTCCTAC CAGCCAAATT
GCTATACAAA AGTAATTACT GTCGAGGGCC AGAAGAAGAT TGTCATTTAT GCAAAGAGGC GTATATATGC TGGCGAGGAA
CTGACTTATA ATTATAAATT TCCACTGGAG GAAAAAAAGA TTCCATGCCA TTGTGGTTCC CAGAGGTAAA TCTCCTTGAG
ATAGATTTTC AAGCATGACA AACTTGTGCC AAAACATAAT GTTGTCTTGT CCTGAAGTAG TCACTACTTA ATGAGTTTTA
GAAAGAACAG TTATTTTATT TTATGCTATG TCTGAAGTAT GACGTTTCTA TGGTATACAT ACATGCCAAA TCCAATTTTT
TTTTTAAAAT TAAATGCTTA GTTCGTTACC CCTTTTTTCA TAAATTTTGC TAACAGCATT CTGTTATATA TGTTTGAAAC
GAGCTTGTAA ATGCTGTTGC CAAGGTTGCA TATTTTATAT TTACCATTGA TTATCTCAAC TGTGGCCTTG GCCTAGCCTA
GATTGCTACT CTCATGGTAC AGCATTTTGA ATCTTTGGAG TTGCATAAAC ACATTTCTTG TTCATTGAAT GCAATCACTT
GTGCTATTAT TGATGCAATA CATATTTTTA TTTACCTCTC CCGCTAACTA TTTTCCGGTT GTTTAGGTGC CGCGGATCAA
TGAATTAGGA AGTAAAGTTT ATAAGTCAGG TAATTGTTAC AGTTAATATT TGCAATGTAA AGCTCATAGT CATAGATGAG
CATTCAGATC ATTCCTTTTC ATATGCTTGT CCGTCTCTCC TGATCTGAGC ATAAAAAACT TGTGTTGGAA ACTAGAATTG
TTGTTTGGTT CAGTAAATTT ATAGTGTTCA TTTTTACAGT AAGCGAAAAT TCTGCCAACA TTAAACAACA TATGTAAATT
TGCCTCATAT GGACCAAAAT TCGTTGAATT CCTTCCATTG TGTATTCTGA TCACTTGTTA TCTTTGGCAG GAGGTAACTG
CAATTGGGTG CTACCCCAGT ATGTATGTGT CATGCGTGCT TGTCGATTGT ACTGGGCAGA AGTTCACTGC AGAAATGTTC
TTGGATTTAC TGACAGGTAC CTGTGCAATC TGCAGCTCAT GCTATCATTA TGCACCAAAA GGGAAACAAA AACTGAAGGT
CATTATTTGT Tgagtaaatt gcgctttggg ctaggtattc ttgccaaagt ttcactttgg atcaccctta agtgttattt
tttcactttg ggctaggtat tgttggcaaa TGTTAATCAG ACATTTTGGA CCGGGTGACC CACATGCAAA TGAGACATGG
ACAACAGAGA TGGTTAGTCT CATTGACATG TGGGCCACCC AGTCCAAAGT GCAACTTTTG CCAAAGAATG TTCCCAAGGC
GGTCCAAATT GAAACTTTGG CAAGAATACA TAACCGAAAG CACAATTTAC TATTGTTTGT TTCTAGTGAC ATAAGATCCC
TACTAGGTCG TTGCTTACTT AACATTTGCT ACCTACCCTA AATAGATACA CTGTATTTTT CATCCAAATT TCGCTGAAGG
TTAGCACCTG TTGTTTGCTA AGATTTTTGT GGATTTTATC CAAATCAATT GAACTGAAGA AAATTGTTTA AAGATTAATA
TCCATACAGT GAATTTGATC ACTTGGGCAT GGAGAAGTGA TTCCAGGGTT TAATATAGCG ATTTTGTTCA AGAACAAAAT
TATTGCACTC ACAGTTAGAT TTATTAAAAC AATCATGGGT AATGGATATA AATTTACTTA GATTTATTAA AGCAATCATG
AGTAATGGAT ATAAATTTAC CTTAGATTTA TTAAAGCGAT GTAAATTTAC TGCAGAAACC TTATGTCGGT ATCTCCAGTT
CCTTCAACAT GTGAGGACTA TGAGAAAAAT GTACTGTGCA TGACAATACC TGATCTTCTG GCCAACCTTC AATGCTGTTT
CAATCATAAA ATTCTGTACG GCTTGTTGAC TTTAAAATGA CTTCATGGAG ATGGAGTTCT TTATTCTTTC TTTTGTCCAT
TTTTCAGGAT GGTAATTGTG TAGCAAGGTA TGGGATCGTG GAACATACTG TACTGCAAAA AGATCACAAA GTTGCTGAGC
TTTCTGGCGC AGAAGAATTT GAACACGTTA TTTATTTAGG TTAGATGGAC TAATTCGGGC TATCCAGAGG AAGGTAAAGC
GCTCAAGTGT GGACTGATGG ACTTGTTGGT TGCCTTAGTG TGTCTCCTGA ACGAGGTTCA TGTTTACTTG CTGACAAGGT
TAATACTGCC CCTTCTTGTA CAGGCCAACA ACATTATTAC ATTGACTGGA TTGAGGATAT AGAGTTTACA CGGTGATTTC
TTCCCGGGGG TACATTTGAA TGAACCCCTG GTCATTTTCA ATTTTTTTTG AAGCATCTAA TTAGCTGTAA AGTTAAAATA
AACCCTATAA CAATAACAAT GACCATAATA ATATCTGTCT TCACCTTTTG AGATGTGTGC TGTTTGCACT GAAGTAAGTC
ACTCTGATGC CTTGCCATTC TGTGAATATA GCGACCGGAT TAGCCATCTC GTTTGCACAT AAGAAATTTG CAGTCCTGCT
TCATGGGCCT CTTCTGCATG TGCCAACATC CAGAGTCAAC ATGAGTGCAG TTTGGGCTTC TGTTTGTATA TATATCATTT
ATTTATAATC ATACAGTACC CAAGATGTGG TTTTAGTTTC AGCAGGGCAA GTCTACTGCT TTTGAGACCA TTCTTGATGA
GACCATTTCA TTTTCAATTA ATGTCATGCT AAATCACACT TCCATGCAAG CAGATTTTAC ACCACTTGTA TGCTATAAAT
CACACTTGTT TGTGTGAGCC AATCAATGTT CATGGACCTA CTCCTGTTGT TGCTGCAGGT ACATGGATAC ATTTAATCTA
TCATCCGTGG TGTATGTGTA TGTATTTCGT CCAGAAAAAA AAAAGCATCC GAATCATGTG GTATGTGTTC CATTACTTTG
CTTGTCCGGA TTCTTTAACT GTTAAGTACG GGGCCATGCG CCCATGCCTT TTTTATTTGG ACTGCTCATG CATTAATCAG
CCACAGAATT ACCATTGGCA GGTCAGGTGG ATACAGACGT GCATGAATAT CTGATATCAC AATCGTAAGT ATGAATTCAA
GTATTTTACC AGCTTATATG TACTTTGTGC AGGCTAACAA CAGGGCAAAA GCAAGCCACT AACAACCAAC CCGTTCC

Locus: Os12g0613200

Loading...

Locus: Os12g0613200

Loading...