Os12t0613200-03

Locus

Os12g0613200

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET43, SDG717

Oryzabase Gene Name Synonym(s)

SET protein 43

Transcript Evidence

AK069599 (DDBJ, Best hit)

Protein Evidence

B9GE94 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

SET domain (IPR001214)

Post-SET domain (IPR003616)

Full-length cDNA

J023025P12 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0613200-03)

RiceXPro (AK069599)

Others

Oryzabase (13406)

KEGG (Os12t0613200-03 (EC:2.1.1.43))

Transcript

2938 bp

>Os12t0613200-03 Hypothetical conserved gene.
TGAAATTTCGGATATGGCTGAAATGGCTCGAGATGAAATTTCAGATATGGCTGTAGATAC
AATACCCTGCCCTGCTGATATGGCGGCATCTGGAACATCAACTGTTCCTGAAGTGACAAC
AGACAAACTGATCATTCCTTACGTGGAACATCAATCGCCCTCTGCATCTCATGCAAGTAT
ATTTGAAAAGTTGGATGCACATGAAGAAGCTGAATTGGATGACAGTTTTGATGAGGTGCC
TCCTGGAACAGAGGCTGGCTTAGCTTCATTGGTGATTATGGAGAAAAACAAATACCAGCC
CTCAAAATCAGTAGACTCAGTGCTTGACATTTATAGATATACTAGTTGGGCATTCTTCAG
GCAAATACTGCATGAGAGTGTAATGAAAGAGTGGGCATCTCTCTTCTCAGGTGCTCTCAG
CAATTGTTTTGACTCATGGTATGCCAGGAAAAATATTGTGGCTAAAACCATGGATGATAC
ATTGAGACCCAAAGAATATACTTACTACAGGAAGAGGAAACTGAGGAAAAACTGTGAAGC
ATCATCATCAGAAAAACCAATGGATGAGCAGCTCTCCAGACCTCTTCGTGATCTTGTTGA
ATGCAAGGTTAATATGAAAAATATCCATCGATCAAGCAAGGCTGGGATTTCGCAGAGAGT
TTCTGTTGTGGAGAAGCCCTCCAAAAAGCGTGCCAAACCTTCACATAATGATAATATTAA
TCTGAATATCCAGCAGGACTTGAAACTCCTTTCCGACAAGGTGCCAAAGAGAAACAGGTC
TTCCCATCCTACCAGTAAGCCTCTTGTTAGTAGCAAAGTGCCTACTGAGGATAGAACTAC
ATCAGCAATGCCTGCAAAGAAAAGAAAGCAGAAAAACTTGGCCACTGAGTCCAACCTGAA
GACAAAAGCAGTAATTTTATCTCCAGAATCACATGGTTGTGAAGCGCCTACTGAGAAAAG
AACTACAGCTATAATGCCTGTAAACAAAAGAAAGAAAAACTTGTCTGGTGAATCCAAACT
GAAGGCAAAACCGTTAACAAGTCCAGAATCGTATGTTTGTGAAGCTCCTATTGACAATAG
AACTACATCTACAATGCCTGCGAAGAAAAGAAAGCAGAAAAACTTGTCCAATGAGTCCAA
CCTGAAGAAAAAACCGTTGGTTTTATGTCCTGAATCATATGGTTGTGCAAGAGCTTCTGT
GAGTGGATGGGAATGGCGTGATTGGGCACGCAATGCCACTCCATCAGAAAGAGCTCAAGT
GAGAGGCTACCGAGTGAGGAGTATTCTCTCAGCTCCAGAAAATAATGTATTGAAAAGTTC
ACAAGTTAAGGGCTCATCTGCAAGAACAAACCGGGTTAAGCTACGGAATCTGTTAGCAGC
CGCTGAAGGCACTGACCTACTAAAAATTATGCAATCGAAGTCAAGGAAGAAGCGGCTACG
TTTTCAAAGGAGTAAGATCCATGAATGGGGTCTGGTGGCTCTTGAGTCTATTGATGCAGA
AGATTTTGTAATTGAATATGTTGGTGAGCTGATCCGCCGACAGGTCTCGGACATACGCGA
GGATCAATACGAGAAAAGTGGAATTGGAAGCAGTTACCTTTTCCGTTTGGACGATGACTA
TGTGGTTGATGCTACTAAGCGTGGTGGGTTAGCAAGATTCATCAACCATTCTTGTGATCC
AAATTGCTATACAAAAGTAATTACTGTCGAGGGCCAGAAGAAGATTGTCATTTATGCAAA
GAGGCGTATATATGCTGGCGAGGAACTGACTTATAATTATAAATTTCCACTGGAGGAAAA
AAAGATTCCATGCCATTGTGGTTCCCAGAGGTGCCGCGGATCAATGAATTAGGAAGTAAA
GTTTATAAGTCAGGAGGTAACTGCAATTGGGTGCTACCCCAGTATGTATGTGTCATGCGT
GCTTGTCGATTGTACTGGGCAGAAGTTCACTGCAGAAATGTTCTTGGATTTACTGACAGG
ATGGTAATTGTGTAGCAAGGTATGGGATCGTGGAACATACTGTACTGCAAAAAGATCACA
AAGTTGCTGAGCTTTCTGGCGCAGAAGAATTTGAACACGTTATTTATTTAGGTTAGATGG
ACTAATTCGGGCTATCCAGAGGAAGGCCAACAACATTATTACATTGACTGGATTGAGGAT
ATAGAGTTTACACGGTGATTTCTTCCCGGGGGTACATTTGAATGAACCCCTGGTCATTTT
CAATTTTTTTTGAAGCATCTAATTAGCTGTAAAGTTAAAATAAACCCTATAACAATAACA
ATGACCATAATAATATCTGTCTTCACCTTTTGAGATGTGTGCTGTTTGCACTGAAGTAAG
TCACTCTGATGCCTTGCCATTCTGTGAATATAGCGACCGGATTAGCCATCTCGTTTGCAC
ATAAGAAATTTGCAGTCCTGCTTCATGGGCCTCTTCTGCATGTGCCAACATCCAGAGTCA
ACATGAGTGCAGTTTGGGCTTCTGTTTGTATATATATCATTTATTTATAATCATACAGTA
CCCAAGATGTGGTTTTAGTTTCAGCAGGGCAAGTCTACTGCTTTTGAGACCATTCTTGAT
GAGACCATTTCATTTTCAATTAATGTCATGCTAAATCACACTTCCATGCAAGCAGATTTT
ACACCACTTGTATGCTATAAATCACACTTGTTTGTGTGAGCCAATCAATGTTCATGGACC
TACTCCTGTTGTTGCTGCAGGTACATGGATACATTTAATCTATCATCCGTGGTGTATGTG
TATGTATTTCGTCCAGAAAAAAAAAAGCATCCGAATCATGTGGTCAGGTGGATACAGACG
TGCATGAATATCTGATATCACAATCGTAAGTATGAATTCAAGTATTTTACCAGCTTATAT
GTACTTTGTGCAGGCTAACAACAGGGCAAAAGCAAGCCACTAACAACCAACCCGTTCC

CDS

1851 bp

>Os12t0613200-03 Hypothetical conserved gene.
GAAATTTCGGATATGGCTGAAATGGCTCGAGATGAAATTTCAGATATGGCTGTAGATACA
ATACCCTGCCCTGCTGATATGGCGGCATCTGGAACATCAACTGTTCCTGAAGTGACAACA
GACAAACTGATCATTCCTTACGTGGAACATCAATCGCCCTCTGCATCTCATGCAAGTATA
TTTGAAAAGTTGGATGCACATGAAGAAGCTGAATTGGATGACAGTTTTGATGAGGTGCCT
CCTGGAACAGAGGCTGGCTTAGCTTCATTGGTGATTATGGAGAAAAACAAATACCAGCCC
TCAAAATCAGTAGACTCAGTGCTTGACATTTATAGATATACTAGTTGGGCATTCTTCAGG
CAAATACTGCATGAGAGTGTAATGAAAGAGTGGGCATCTCTCTTCTCAGGTGCTCTCAGC
AATTGTTTTGACTCATGGTATGCCAGGAAAAATATTGTGGCTAAAACCATGGATGATACA
TTGAGACCCAAAGAATATACTTACTACAGGAAGAGGAAACTGAGGAAAAACTGTGAAGCA
TCATCATCAGAAAAACCAATGGATGAGCAGCTCTCCAGACCTCTTCGTGATCTTGTTGAA
TGCAAGGTTAATATGAAAAATATCCATCGATCAAGCAAGGCTGGGATTTCGCAGAGAGTT
TCTGTTGTGGAGAAGCCCTCCAAAAAGCGTGCCAAACCTTCACATAATGATAATATTAAT
CTGAATATCCAGCAGGACTTGAAACTCCTTTCCGACAAGGTGCCAAAGAGAAACAGGTCT
TCCCATCCTACCAGTAAGCCTCTTGTTAGTAGCAAAGTGCCTACTGAGGATAGAACTACA
TCAGCAATGCCTGCAAAGAAAAGAAAGCAGAAAAACTTGGCCACTGAGTCCAACCTGAAG
ACAAAAGCAGTAATTTTATCTCCAGAATCACATGGTTGTGAAGCGCCTACTGAGAAAAGA
ACTACAGCTATAATGCCTGTAAACAAAAGAAAGAAAAACTTGTCTGGTGAATCCAAACTG
AAGGCAAAACCGTTAACAAGTCCAGAATCGTATGTTTGTGAAGCTCCTATTGACAATAGA
ACTACATCTACAATGCCTGCGAAGAAAAGAAAGCAGAAAAACTTGTCCAATGAGTCCAAC
CTGAAGAAAAAACCGTTGGTTTTATGTCCTGAATCATATGGTTGTGCAAGAGCTTCTGTG
AGTGGATGGGAATGGCGTGATTGGGCACGCAATGCCACTCCATCAGAAAGAGCTCAAGTG
AGAGGCTACCGAGTGAGGAGTATTCTCTCAGCTCCAGAAAATAATGTATTGAAAAGTTCA
CAAGTTAAGGGCTCATCTGCAAGAACAAACCGGGTTAAGCTACGGAATCTGTTAGCAGCC
GCTGAAGGCACTGACCTACTAAAAATTATGCAATCGAAGTCAAGGAAGAAGCGGCTACGT
TTTCAAAGGAGTAAGATCCATGAATGGGGTCTGGTGGCTCTTGAGTCTATTGATGCAGAA
GATTTTGTAATTGAATATGTTGGTGAGCTGATCCGCCGACAGGTCTCGGACATACGCGAG
GATCAATACGAGAAAAGTGGAATTGGAAGCAGTTACCTTTTCCGTTTGGACGATGACTAT
GTGGTTGATGCTACTAAGCGTGGTGGGTTAGCAAGATTCATCAACCATTCTTGTGATCCA
AATTGCTATACAAAAGTAATTACTGTCGAGGGCCAGAAGAAGATTGTCATTTATGCAAAG
AGGCGTATATATGCTGGCGAGGAACTGACTTATAATTATAAATTTCCACTGGAGGAAAAA
AAGATTCCATGCCATTGTGGTTCCCAGAGGTGCCGCGGATCAATGAATTAG

Protein

617 aa

>Os12t0613200-03 Hypothetical conserved gene.
EISDMAEMARDEISDMAVDTIPCPADMAASGTSTVPEVTTDKLIIPYVEHQSPSASHASI
FEKLDAHEEAELDDSFDEVPPGTEAGLASLVIMEKNKYQPSKSVDSVLDIYRYTSWAFFR
QILHESVMKEWASLFSGALSNCFDSWYARKNIVAKTMDDTLRPKEYTYYRKRKLRKNCEA
SSSEKPMDEQLSRPLRDLVECKVNMKNIHRSSKAGISQRVSVVEKPSKKRAKPSHNDNIN
LNIQQDLKLLSDKVPKRNRSSHPTSKPLVSSKVPTEDRTTSAMPAKKRKQKNLATESNLK
TKAVILSPESHGCEAPTEKRTTAIMPVNKRKKNLSGESKLKAKPLTSPESYVCEAPIDNR
TTSTMPAKKRKQKNLSNESNLKKKPLVLCPESYGCARASVSGWEWRDWARNATPSERAQV
RGYRVRSILSAPENNVLKSSQVKGSSARTNRVKLRNLLAAAEGTDLLKIMQSKSRKKRLR
FQRSKIHEWGLVALESIDAEDFVIEYVGELIRRQVSDIREDQYEKSGIGSSYLFRLDDDY
VVDATKRGGLARFINHSCDPNCYTKVITVEGQKKIVIYAKRRIYAGEELTYNYKFPLEEK
KIPCHCGSQRCRGSMN*

5'UTR

chr12:25972219..25972219 (- strand) : 1 bp

CDS

chr12:25972077..25972218 (- strand) : 142 bp

chr12:25971372..25971998 (- strand) : 627 bp

chr12:25970641..25971290 (- strand) : 650 bp

chr12:25970441..25970563 (- strand) : 123 bp

chr12:25970275..25970355 (- strand) : 81 bp

chr12:25969970..25970023 (- strand) : 54 bp

chr12:25969744..25969895 (- strand) : 152 bp

chr12:25969241..25969262 (- strand) : 22 bp

3'UTR

chr12:25969220..25969240 (- strand) : 21 bp

chr12:25968833..25968938 (- strand) : 106 bp

chr12:25967736..25967881 (- strand) : 146 bp

chr12:25966949..25967625 (- strand) : 677 bp

chr12:25966692..25966827 (- strand) : 136 bp

FASTA

>Os12t0613200-03 class=Sequence position=chr12:25966692..25972219 (- strand)
TGAAATTTCG GATATGGCTG AAATGGCTCG AGATGAAATT TCAGATATGG CTGTAGATAC AATACCCTGC CCTGCTGATA
TGGCGGCATC TGGAACATCA ACTGTTCCTG AAGTGACAAC AGACAAACTG ATCATTCCTT ACGGTAAATG AATAACATCT
TCTGTTGCAT TGCCTTACCT GAGCAACATT AAATTATTCT AATTCCTTAA TTTGGATGCA GTGGAACATC AATCGCCCTC
TGCATCTCAT GCAAGTATAT TTGAAAAGTT GGATGCACAT GAAGAAGCTG AATTGGATGA CAGTTTTGAT GAGGTGCCTC
CTGGAACAGA GGCTGGCTTA GCTTCATTGG TGATTATGGA GAAAAACAAA TACCAGCCCT CAAAATCAGT AGACTCAGTG
CTTGACATTT ATAGATATAC TAGTTGGGCA TTCTTCAGGC AAATACTGCA TGAGAGTGTA ATGAAAGAGT GGGCATCTCT
CTTCTCAGGT GCTCTCAGCA ATTGTTTTGA CTCATGGTAT GCCAGGAAAA ATATTGTGGC TAAAACCATG GATGATACAT
TGAGACCCAA AGAATATACT TACTACAGGA AGAGGAAACT GAGGAAAAAC TGTGAAGCAT CATCATCAGA AAAACCAATG
GATGAGCAGC TCTCCAGACC TCTTCGTGAT CTTGTTGAAT GCAAGGTTAA TATGAAAAAT ATCCATCGAT CAAGCAAGGC
TGGGATTTCG CAGAGAGTTT CTGTTGTGGA GAAGCCCTCC AAAAAGCGTG CCAAACCTTC ACATAATGAT AATATTAATC
TGAATATCCA GCAGGACTTG AAACTCCTTT CCGACAAGGT GCCAAAGAGT GAGTCATTCA GTCCTCATCT CCATCTCCTT
TTTAATATAA ATACATTTCA CAGAGTTAAC ATTCATCTTT CGTTGCCAGG AAACAGGTCT TCCCATCCTA CCAGTAAGCC
TCTTGTTAGT AGCAAAGTGC CTACTGAGGA TAGAACTACA TCAGCAATGC CTGCAAAGAA AAGAAAGCAG AAAAACTTGG
CCACTGAGTC CAACCTGAAG ACAAAAGCAG TAATTTTATC TCCAGAATCA CATGGTTGTG AAGCGCCTAC TGAGAAAAGA
ACTACAGCTA TAATGCCTGT AAACAAAAGA AAGAAAAACT TGTCTGGTGA ATCCAAACTG AAGGCAAAAC CGTTAACAAG
TCCAGAATCG TATGTTTGTG AAGCTCCTAT TGACAATAGA ACTACATCTA CAATGCCTGC GAAGAAAAGA AAGCAGAAAA
ACTTGTCCAA TGAGTCCAAC CTGAAGAAAA AACCGTTGGT TTTATGTCCT GAATCATATG GTTGTGCAAG AGCTTCTGTG
AGTGGATGGG AATGGCGTGA TTGGGCACGC AATGCCACTC CATCAGAAAG AGCTCAAGTG AGAGGCTACC GAGTGAGGAG
TATTCTCTCA GCTCCAGAAA ATAATGTATT GAAAAGTTCA CAAGTTAAGG GCTCATCTGC AAGAACAAAC CGGGTTAAGC
TACGGAATCT GTTAGCAGCC GCTGAAGGCA CTGACCTACT AAAAATTATG CAATCGAAGG TAAAACAGTA TATTTTATTT
TGTCAAGTGC AAATGTTTCT ATTCTGTGAA ATTTGAAATT TGAAAATGGT ATACAGTCAA GGAAGAAGCG GCTACGTTTT
CAAAGGAGTA AGATCCATGA ATGGGGTCTG GTGGCTCTTG AGTCTATTGA TGCAGAAGAT TTTGTAATTG AATATGTTGG
TGAGCTGATC CGCCGACAGG TAATTATGAC TTAATGAACA ACGATCCCTT CATTGATTTA CTGCATTTGA GCAACATGTT
ATAAGATTGA TTTATATCCC ACAGGTCTCG GACATACGCG AGGATCAATA CGAGAAAAGT GGAATTGGAA GCAGTTACCT
TTTCCGTTTG GACGATGACT ATGTGGTAGG TGTAGCCAGT TTCCTTCAAC TACATCCATC TAAGATGCTA TGTACATTTT
TTTACTTCTT TTTTATGTTC GCCTATTAGA CAACAGCAGA GTTAGTTGGT TTTTGTTTGT TTTGATGTAT GGTCAGGATA
GTTCTGTTGT TTTGTAACCT CAACCTGTTC TATATTGTGC TCTTTCTTTA CCAAATTTTA TGAGTGCACC TTGTGCTCTT
CTGTATTAAT TGTGCCTATT TTCTTAATCT TTGAAGGTTG ATGCTACTAA GCGTGGTGGG TTAGCAAGAT TCATCAACCA
TTCTTGTGAT GTAAGCTGTT TAACATGAAA CTTTCAGTTG TGATGCTTAT TCTATGCTAA ATGACGTCTT GTTTTTCCTA
CCAGCCAAAT TGCTATACAA AAGTAATTAC TGTCGAGGGC CAGAAGAAGA TTGTCATTTA TGCAAAGAGG CGTATATATG
CTGGCGAGGA ACTGACTTAT AATTATAAAT TTCCACTGGA GGAAAAAAAG ATTCCATGCC ATTGTGGTTC CCAGAGGTAA
ATCTCCTTGA GATAGATTTT CAAGCATGAC AAACTTGTGC CAAAACATAA TGTTGTCTTG TCCTGAAGTA GTCACTACTT
AATGAGTTTT AGAAAGAACA GTTATTTTAT TTTATGCTAT GTCTGAAGTA TGACGTTTCT ATGGTATACA TACATGCCAA
ATCCAATTTT TTTTTTAAAA TTAAATGCTT AGTTCGTTAC CCCTTTTTTC ATAAATTTTG CTAACAGCAT TCTGTTATAT
ATGTTTGAAA CGAGCTTGTA AATGCTGTTG CCAAGGTTGC ATATTTTATA TTTACCATTG ATTATCTCAA CTGTGGCCTT
GGCCTAGCCT AGATTGCTAC TCTCATGGTA CAGCATTTTG AATCTTTGGA GTTGCATAAA CACATTTCTT GTTCATTGAA
TGCAATCACT TGTGCTATTA TTGATGCAAT ACATATTTTT ATTTACCTCT CCCGCTAACT ATTTTCCGGT TGTTTAGGTG
CCGCGGATCA ATGAATTAGG AAGTAAAGTT TATAAGTCAG GTAATTGTTA CAGTTAATAT TTGCAATGTA AAGCTCATAG
TCATAGATGA GCATTCAGAT CATTCCTTTT CATATGCTTG TCCGTCTCTC CTGATCTGAG CATAAAAAAC TTGTGTTGGA
AACTAGAATT GTTGTTTGGT TCAGTAAATT TATAGTGTTC ATTTTTACAG TAAGCGAAAA TTCTGCCAAC ATTAAACAAC
ATATGTAAAT TTGCCTCATA TGGACCAAAA TTCGTTGAAT TCCTTCCATT GTGTATTCTG ATCACTTGTT ATCTTTGGCA
GGAGGTAACT GCAATTGGGT GCTACCCCAG TATGTATGTG TCATGCGTGC TTGTCGATTG TACTGGGCAG AAGTTCACTG
CAGAAATGTT CTTGGATTTA CTGACAGGTA CCTGTGCAAT CTGCAGCTCA TGCTATCATT ATGCACCAAA AGGGAAACAA
AAACTGAAGG TCATTATTTG TTgagtaaat tgcgctttgg gctaggtatt cttgccaaag tttcactttg gatcaccctt
aagtgttatt ttttcacttt gggctaggta ttgttggcaa aTGTTAATCA GACATTTTGG ACCGGGTGAC CCACATGCAA
ATGAGACATG GACAACAGAG ATGGTTAGTC TCATTGACAT GTGGGCCACC CAGTCCAAAG TGCAACTTTT GCCAAAGAAT
GTTCCCAAGG CGGTCCAAAT TGAAACTTTG GCAAGAATAC ATAACCGAAA GCACAATTTA CTATTGTTTG TTTCTAGTGA
CATAAGATCC CTACTAGGTC GTTGCTTACT TAACATTTGC TACCTACCCT AAATAGATAC ACTGTATTTT TCATCCAAAT
TTCGCTGAAG GTTAGCACCT GTTGTTTGCT AAGATTTTTG TGGATTTTAT CCAAATCAAT TGAACTGAAG AAAATTGTTT
AAAGATTAAT ATCCATACAG TGAATTTGAT CACTTGGGCA TGGAGAAGTG ATTCCAGGGT TTAATATAGC GATTTTGTTC
AAGAACAAAA TTATTGCACT CACAGTTAGA TTTATTAAAA CAATCATGGG TAATGGATAT AAATTTACTT AGATTTATTA
AAGCAATCAT GAGTAATGGA TATAAATTTA CCTTAGATTT ATTAAAGCGA TGTAAATTTA CTGCAGAAAC CTTATGTCGG
TATCTCCAGT TCCTTCAACA TGTGAGGACT ATGAGAAAAA TGTACTGTGC ATGACAATAC CTGATCTTCT GGCCAACCTT
CAATGCTGTT TCAATCATAA AATTCTGTAC GGCTTGTTGA CTTTAAAATG ACTTCATGGA GATGGAGTTC TTTATTCTTT
CTTTTGTCCA TTTTTCAGGA TGGTAATTGT GTAGCAAGGT ATGGGATCGT GGAACATACT GTACTGCAAA AAGATCACAA
AGTTGCTGAG CTTTCTGGCG CAGAAGAATT TGAACACGTT ATTTATTTAG GTTAGATGGA CTAATTCGGG CTATCCAGAG
GAAGGTAAAG CGCTCAAGTG TGGACTGATG GACTTGTTGG TTGCCTTAGT GTGTCTCCTG AACGAGGTTC ATGTTTACTT
GCTGACAAGG TTAATACTGC CCCTTCTTGT ACAGGCCAAC AACATTATTA CATTGACTGG ATTGAGGATA TAGAGTTTAC
ACGGTGATTT CTTCCCGGGG GTACATTTGA ATGAACCCCT GGTCATTTTC AATTTTTTTT GAAGCATCTA ATTAGCTGTA
AAGTTAAAAT AAACCCTATA ACAATAACAA TGACCATAAT AATATCTGTC TTCACCTTTT GAGATGTGTG CTGTTTGCAC
TGAAGTAAGT CACTCTGATG CCTTGCCATT CTGTGAATAT AGCGACCGGA TTAGCCATCT CGTTTGCACA TAAGAAATTT
GCAGTCCTGC TTCATGGGCC TCTTCTGCAT GTGCCAACAT CCAGAGTCAA CATGAGTGCA GTTTGGGCTT CTGTTTGTAT
ATATATCATT TATTTATAAT CATACAGTAC CCAAGATGTG GTTTTAGTTT CAGCAGGGCA AGTCTACTGC TTTTGAGACC
ATTCTTGATG AGACCATTTC ATTTTCAATT AATGTCATGC TAAATCACAC TTCCATGCAA GCAGATTTTA CACCACTTGT
ATGCTATAAA TCACACTTGT TTGTGTGAGC CAATCAATGT TCATGGACCT ACTCCTGTTG TTGCTGCAGG TACATGGATA
CATTTAATCT ATCATCCGTG GTGTATGTGT ATGTATTTCG TCCAGAAAAA AAAAAGCATC CGAATCATGT GGTATGTGTT
CCATTACTTT GCTTGTCCGG ATTCTTTAAC TGTTAAGTAC GGGGCCATGC GCCCATGCCT TTTTTATTTG GACTGCTCAT
GCATTAATCA GCCACAGAAT TACCATTGGC AGGTCAGGTG GATACAGACG TGCATGAATA TCTGATATCA CAATCGTAAG
TATGAATTCA AGTATTTTAC CAGCTTATAT GTACTTTGTG CAGGCTAACA ACAGGGCAAA AGCAAGCCAC TAACAACCAA
CCCGTTCC

Locus: Os12g0613200

Loading...

Locus: Os12g0613200

Loading...