Os12t0613700-01

Locus

Os12g0613700

Description

Transcriptional factor B3 family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ARF6B

CGSNL Gene Name

AUXIN RESPONSE FACTOR 6B

Oryzabase Gene Symbol Synonym(s)

OsARF6b, OsARF25, ARF25

Oryzabase Gene Name Synonym(s)

auxin response factor-6B, auxin response factor 6B, auxin response factor-25, auxin response factor 25

Transcript Evidence

AK121703 (DDBJ, Best hit)

Protein Evidence

Q2QM84 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Biological Process: response to hormone stimulus (GO:0009725)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Transcriptional factor B3 (IPR003340)

Auxin response factor (IPR010525)

Aux/IAA-ARF-dimerisation (IPR011525)

DNA-binding pseudobarrel domain (IPR015300)

Full-length cDNA

J033074F07 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0613700-01)

RiceXPro (AK121703)

Others

Oryzabase (9993)

KEGG (Os12t0613700-01)

Transcript

3877 bp

>Os12t0613700-01 Transcriptional factor B3 family protein.
GAAGAAAAAAAAAACTCGACCACCACCTCCACCACTCACACCTCGATCCGGCCATGGCGG
CCTAGCCCTAGCACCTAGGGTTCGCGCCCCCACCACCCTCCCCGCCGTCTCGGAGACCGC
GCGCCCCCAGCTCCCGCCTCGCTGTCGCGCCGCCTGATTCCGCCGCCGGCGCCGAATGCT
ACGCCGTTTggtggtggtggtggtcgtcgtcgcctgattccgcgatctcgtgagctccgg
ggggtgcgcggttgcggcggcggcgcctgagaggaaggctggactcgtccgcggcggcgg
cggctgcgGGCTAGTGTCGGTGGCGATTTGAGGGCGGCGGTTTGGGTTAGCCGTCGCCGA
GAGTGAAGGTGCTGTGTTTTGAGTGCTTGGGATGAGCTGCGTGTTGATCTGATGAACTCG
GGGTCGGCGGCGTTCTTCGGTTTCTCCGCTCACTTGCTCCCGCCGTTGGCGAAAATCCGG
TTCTTCGGATCGAGTTGCGGTCGCCTGGGTGTTTTTCATCAGTTTTGGGTGAAAATACTC
GAGCTCTGAGGGGGGTGATTGGTTTCCAAGTTTGATTGATTTAAAGAGTTTGTGTGGAAT
TTTTTCGGGGAGATGAAGGGGAGGATTTGCTGCGACGGTCCAGGTTTTGGTTAGTTGTTG
AGGGAGAAAAAAATGGAAGATATTTCTGGGCGCAAGAGAGGAAGGCAGGTGTTTGCTGCT
GCTGCTGGGAGCATGATGGGAAGCTGACCAGCAGCTTCTCCGGTATCCTGGTGCGGCGGA
GTTTCGTGCTCTTTGGCGACGGGTGCACTGGTGATTGGAGATGAAGCTCTCTCCGCCGGC
GTCGGCGGATATGCCGCAGGCCTTGCCGGAGAACGACGGGGAACAAAGATGTCTGAACTC
GGAGCTGTGGCATGCATGCGCTGGGCCCCTTGTGTCTTTGCCAGTGGTCAGGAGCAGGGT
CGTCTACTTTCCACAGGGCCATAGCGAGCAGGTTGCGGCATCAACTAATAAGGAAGTTGA
TGCTCAAATCCCAAATTATCCAAACTTACCTCCTCAGTTAATCTGCCAGCTTCATAATGT
CACCATGCATGCTGATGCAGAGACAGATGAAGTTTATGCTCAGATGACATTGCAACCATT
GAGCCCGGAAGAGCAAAAGGAGCCTTTCCTTCCAATGGAGTTGGGTGCTGCTAGCAAGCA
ACCCACTAATTACTTCTGCAAGACATTGACTGCAAGTGACACGAGCACTCATGGTGGTTT
CTCTGTTCCCCGCCGGGCAGCTGAGAAAGTCTTCCCTCCACTAGATTTTTCACAGCAGCC
TCCGGCACAGGAGCTGATTGCAAGAGATTTGCATGATAATGAATGGAAATTTCGCCATAT
ATTTCGTGGTCAGCCTAAAAGGCATCTCCTGACAACAGGCTGGAGTGTGTTTGTGAGTGC
GAAAAGACTAGTAGCAGGAGACTCTGTTATATTTATCTGGAATGATAACAATCAACTTCT
TTTGGGAATACGTCGTGCAAATCGCCAACAGACTGTTATGCCCTCTTCCGTGTTGTCAAG
CGATAGCATGCATATAGGTCTTCTTGCAGCAGCAGCTCATGCTGCAGCCACAAATAGTCG
CTTCACTATTTTCTATAACCCCAGGGCTAGCCCTTCTGAATTTGTGATTCCATTGGCCAA
GTATGTGAAAGCTGTTTACCACACACGTGTATCTGTTGGAATGCGTTTTAGAATGCTTTT
CGAGACAGAGGAGTCAAGTGTCAGGCGATACATGGGTACAATCACCAGCATAAGTGATCT
AGATTCAGTGCGCTGGCCAAACTCACACTGGCGTTCTGTTAAGGTTGGTTGGGATGAGTC
CACCACTGGTGATAAACAGCCAAGGGTTTCTCTTTGGGAGATTGAGCCTTTGACAACCTT
TCCGATGTACCCCAGTGCTTTTCCTTTAAGACTTAAGCGTCCGTGGGCTTCAGGACTGCC
TATGCATGGCATGTTCAATGGTGGGGGAAATGACGATTTTGCACGCTATTCTTCTCTCAT
GTGGCTTCGAGACGGAAATAGAGGAACCCAGTCCCTGAATTTTCAAGGACATGGAGTCTC
ACCATGGCTTCAGCCAAGAATAGATTCTCCATTGCTGGGCCTTAAGCCAGACACGTACCA
GCAAATGGCTGCAGCAGCACTGGAAGAAATTCGATATGGGGACCCTTCAAAGCAGCATCC
AGCTACTCTGCAATACCAACAGACTCATAATCTGAACAGTGGATTAAATTCTCTGTTTGC
AAGCCATGTTCTAGGGCAGGTGCAGTTTCAACCTCAGCAGTCACCCCTGCAAGTTGTTCA
GCAAGGCCATTGTCAGAACACTGGTGACTCTGGGTTCCTTCAAGGTCAGCTTCCACGGCT
GCAGTTGCATAACACTCAGCAGCTGCTAAAGGAGCAAGAGTTGCAGCAGCAGCAAAGACA
GCATGTTTTACAAGAGCAATCTAGTCAAGAGATGCAACAGCAGCTCCCATCTAGTGATCA
TCATGTTGCTGATGTAGCTTCTGAGTCTGGATCTGCTCCTCAGGCACAATCATCATTGCT
TAGTGGATCATCATTCTACAATCAGAACCTCTTAGAAGGAAATAGTGATCCCCCTTTACA
TCTACACAACAATTTCCACAACTTCTCTAACCAGGAAGCCTCAAACCTTCTTATTTTGCC
TCGAAGTAGCCAATTAATGGCATCAGATGGGTGGCCTTCAAAGCGATTAACTTTAGAATC
TGCTGTTCATCCTGAAGCTCCGTCCATGCACCCCAAGATTGAGAAAGTAAATCACCAGGG
TATATCTCATTTTCCTGGCGCCTTTCCACCACAATCAGCAAGAGGCTGTTCCATCGTCCA
GGATTGCAGGGCAGATGCTGAGAACCGCCTACTTTCATCATCATTTGAACTCCAGGATGG
CATGACAAGCATCATAACTGATGCTAACAGAGAAACTGATACTATGGCCATACCTTTGTT
GAGATATAGTGGTGCAGATTTGACAACTGAAAACACCTTAGCAACCTCCAATTGTTTAGG
TGAATCTGGAACGTTCAATCCTCTTAATAACATATCTGTAAATCCATCACAAGGAGCAAC
CTTTGTGAAGGTTTACAAATCAGGGTCCCTTGGGAGATCACTTGACATCTCCAGATTCAG
CAGCTACTGCGAGTTACGTAGTGAGCTTGAGCGTCTCTTTGGTCTTGAAGGCCAACTGGA
GGACCCTGTAAGATCAGGCTGGCAGCTTGTATTTGTCGACCGGGAAAATGACATTCTTCT
CGTCGGCGACGATCCATGGCAGGAGTTTGCAAATAGCGTATGGTGCATCAAAATACTCTC
GCCACAGGAGGTGCAGCAGTTGGTTCGTGGTGGAGACGGCCTTCTGTCCTCACCTGGAGC
AAGGATGCAGCAGAGCAATGCCTGCGACGACTATTCTGCAAGCCACAACATGCAGAATAT
CGCCGGAAACATTGCATCTGTAGCGCCTCTGGACTACTGAGATGTAGACCAGAATCCAAA
CTAAGCACCCTTAAGACTGCAGGGTCACCATTCGTGATCGCCTGCATTCCATGCGATCTT
CACTAGTCCTGTCCGAATCAGTAGCAACTCAGTCAATAATATAGCTAGATGATCCGTTGT
ATTCCATCTGATCATGGACATGCTGTATGATAGCTGCTTTAGCTCTATTAAATCTCTAAT
GGCAGGCAACTAGGCAAGAACAGTTCTATGATGAATGATGGCAGTCGCTGTAGAATTGAC
CTTATTCTGTAGCTATAATATGATGTCTAGAACTGATGATTCCAATTTCCAAATGGAGCC
CGGAACATATTAAAATCAATCATTTGTCGCCTTCTTC

CDS

2700 bp

>Os12t0613700-01 Transcriptional factor B3 family protein.
ATGAAGCTCTCTCCGCCGGCGTCGGCGGATATGCCGCAGGCCTTGCCGGAGAACGACGGG
GAACAAAGATGTCTGAACTCGGAGCTGTGGCATGCATGCGCTGGGCCCCTTGTGTCTTTG
CCAGTGGTCAGGAGCAGGGTCGTCTACTTTCCACAGGGCCATAGCGAGCAGGTTGCGGCA
TCAACTAATAAGGAAGTTGATGCTCAAATCCCAAATTATCCAAACTTACCTCCTCAGTTA
ATCTGCCAGCTTCATAATGTCACCATGCATGCTGATGCAGAGACAGATGAAGTTTATGCT
CAGATGACATTGCAACCATTGAGCCCGGAAGAGCAAAAGGAGCCTTTCCTTCCAATGGAG
TTGGGTGCTGCTAGCAAGCAACCCACTAATTACTTCTGCAAGACATTGACTGCAAGTGAC
ACGAGCACTCATGGTGGTTTCTCTGTTCCCCGCCGGGCAGCTGAGAAAGTCTTCCCTCCA
CTAGATTTTTCACAGCAGCCTCCGGCACAGGAGCTGATTGCAAGAGATTTGCATGATAAT
GAATGGAAATTTCGCCATATATTTCGTGGTCAGCCTAAAAGGCATCTCCTGACAACAGGC
TGGAGTGTGTTTGTGAGTGCGAAAAGACTAGTAGCAGGAGACTCTGTTATATTTATCTGG
AATGATAACAATCAACTTCTTTTGGGAATACGTCGTGCAAATCGCCAACAGACTGTTATG
CCCTCTTCCGTGTTGTCAAGCGATAGCATGCATATAGGTCTTCTTGCAGCAGCAGCTCAT
GCTGCAGCCACAAATAGTCGCTTCACTATTTTCTATAACCCCAGGGCTAGCCCTTCTGAA
TTTGTGATTCCATTGGCCAAGTATGTGAAAGCTGTTTACCACACACGTGTATCTGTTGGA
ATGCGTTTTAGAATGCTTTTCGAGACAGAGGAGTCAAGTGTCAGGCGATACATGGGTACA
ATCACCAGCATAAGTGATCTAGATTCAGTGCGCTGGCCAAACTCACACTGGCGTTCTGTT
AAGGTTGGTTGGGATGAGTCCACCACTGGTGATAAACAGCCAAGGGTTTCTCTTTGGGAG
ATTGAGCCTTTGACAACCTTTCCGATGTACCCCAGTGCTTTTCCTTTAAGACTTAAGCGT
CCGTGGGCTTCAGGACTGCCTATGCATGGCATGTTCAATGGTGGGGGAAATGACGATTTT
GCACGCTATTCTTCTCTCATGTGGCTTCGAGACGGAAATAGAGGAACCCAGTCCCTGAAT
TTTCAAGGACATGGAGTCTCACCATGGCTTCAGCCAAGAATAGATTCTCCATTGCTGGGC
CTTAAGCCAGACACGTACCAGCAAATGGCTGCAGCAGCACTGGAAGAAATTCGATATGGG
GACCCTTCAAAGCAGCATCCAGCTACTCTGCAATACCAACAGACTCATAATCTGAACAGT
GGATTAAATTCTCTGTTTGCAAGCCATGTTCTAGGGCAGGTGCAGTTTCAACCTCAGCAG
TCACCCCTGCAAGTTGTTCAGCAAGGCCATTGTCAGAACACTGGTGACTCTGGGTTCCTT
CAAGGTCAGCTTCCACGGCTGCAGTTGCATAACACTCAGCAGCTGCTAAAGGAGCAAGAG
TTGCAGCAGCAGCAAAGACAGCATGTTTTACAAGAGCAATCTAGTCAAGAGATGCAACAG
CAGCTCCCATCTAGTGATCATCATGTTGCTGATGTAGCTTCTGAGTCTGGATCTGCTCCT
CAGGCACAATCATCATTGCTTAGTGGATCATCATTCTACAATCAGAACCTCTTAGAAGGA
AATAGTGATCCCCCTTTACATCTACACAACAATTTCCACAACTTCTCTAACCAGGAAGCC
TCAAACCTTCTTATTTTGCCTCGAAGTAGCCAATTAATGGCATCAGATGGGTGGCCTTCA
AAGCGATTAACTTTAGAATCTGCTGTTCATCCTGAAGCTCCGTCCATGCACCCCAAGATT
GAGAAAGTAAATCACCAGGGTATATCTCATTTTCCTGGCGCCTTTCCACCACAATCAGCA
AGAGGCTGTTCCATCGTCCAGGATTGCAGGGCAGATGCTGAGAACCGCCTACTTTCATCA
TCATTTGAACTCCAGGATGGCATGACAAGCATCATAACTGATGCTAACAGAGAAACTGAT
ACTATGGCCATACCTTTGTTGAGATATAGTGGTGCAGATTTGACAACTGAAAACACCTTA
GCAACCTCCAATTGTTTAGGTGAATCTGGAACGTTCAATCCTCTTAATAACATATCTGTA
AATCCATCACAAGGAGCAACCTTTGTGAAGGTTTACAAATCAGGGTCCCTTGGGAGATCA
CTTGACATCTCCAGATTCAGCAGCTACTGCGAGTTACGTAGTGAGCTTGAGCGTCTCTTT
GGTCTTGAAGGCCAACTGGAGGACCCTGTAAGATCAGGCTGGCAGCTTGTATTTGTCGAC
CGGGAAAATGACATTCTTCTCGTCGGCGACGATCCATGGCAGGAGTTTGCAAATAGCGTA
TGGTGCATCAAAATACTCTCGCCACAGGAGGTGCAGCAGTTGGTTCGTGGTGGAGACGGC
CTTCTGTCCTCACCTGGAGCAAGGATGCAGCAGAGCAATGCCTGCGACGACTATTCTGCA
AGCCACAACATGCAGAATATCGCCGGAAACATTGCATCTGTAGCGCCTCTGGACTACTGA

Protein

899 aa

>Os12t0613700-01 Transcriptional factor B3 family protein.
MKLSPPASADMPQALPENDGEQRCLNSELWHACAGPLVSLPVVRSRVVYFPQGHSEQVAA
STNKEVDAQIPNYPNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPEEQKEPFLPME
LGAASKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDN
EWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIWNDNNQLLLGIRRANRQQTVM
PSSVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVG
MRFRMLFETEESSVRRYMGTITSISDLDSVRWPNSHWRSVKVGWDESTTGDKQPRVSLWE
IEPLTTFPMYPSAFPLRLKRPWASGLPMHGMFNGGGNDDFARYSSLMWLRDGNRGTQSLN
FQGHGVSPWLQPRIDSPLLGLKPDTYQQMAAAALEEIRYGDPSKQHPATLQYQQTHNLNS
GLNSLFASHVLGQVQFQPQQSPLQVVQQGHCQNTGDSGFLQGQLPRLQLHNTQQLLKEQE
LQQQQRQHVLQEQSSQEMQQQLPSSDHHVADVASESGSAPQAQSSLLSGSSFYNQNLLEG
NSDPPLHLHNNFHNFSNQEASNLLILPRSSQLMASDGWPSKRLTLESAVHPEAPSMHPKI
EKVNHQGISHFPGAFPPQSARGCSIVQDCRADAENRLLSSSFELQDGMTSIITDANRETD
TMAIPLLRYSGADLTTENTLATSNCLGESGTFNPLNNISVNPSQGATFVKVYKSGSLGRS
LDISRFSSYCELRSELERLFGLEGQLEDPVRSGWQLVFVDRENDILLVGDDPWQEFANSV
WCIKILSPQEVQQLVRGGDGLLSSPGARMQQSNACDDYSASHNMQNIAGNIASVAPLDY*

5'UTR

chr12:26007524..26008343 (- strand) : 820 bp

CDS

chr12:26007466..26007523 (- strand) : 58 bp

chr12:26006967..26007079 (- strand) : 113 bp

chr12:26006623..26006721 (- strand) : 99 bp

chr12:26006489..26006545 (- strand) : 57 bp

chr12:26006237..26006392 (- strand) : 156 bp

chr12:26006066..26006150 (- strand) : 85 bp

chr12:26005652..26005742 (- strand) : 91 bp

chr12:26005394..26005558 (- strand) : 165 bp

chr12:26005188..26005310 (- strand) : 123 bp

chr12:26005039..26005114 (- strand) : 76 bp

chr12:26004719..26004875 (- strand) : 157 bp

chr12:26003513..26004642 (- strand) : 1130 bp

chr12:26003026..26003216 (- strand) : 191 bp

chr12:26002727..26002925 (- strand) : 199 bp

3'UTR

chr12:26002370..26002726 (- strand) : 357 bp

FASTA

>Os12t0613700-01 class=Sequence position=chr12:26002370..26008343 (- strand)
GAAGAAAAAA AAAACTCGAC CACCACCTCC ACCACTCACA CCTCGATCCG GCCATGGCGG CCTAGCCCTA GCACCTAGGG
TTCGCGCCCC CACCACCCTC CCCGCCGTCT CGGAGACCGC GCGCCCCCAG CTCCCGCCTC GCTGTCGCGC CGCCTGATTC
CGCCGCCGGC GCCGAATGCT ACGCCGTTTg gtggtggtgg tggtcgtcgt cgcctgattc cgcgatctcg tgagctccgg
ggggtgcgcg gttgcggcgg cggcgcctga gaggaaggct ggactcgtcc gcggcggcgg cggctgcgGG CTAGTGTCGG
TGGCGATTTG AGGGCGGCGG TTTGGGTTAG CCGTCGCCGA GAGTGAAGGT GCTGTGTTTT GAGTGCTTGG GATGAGCTGC
GTGTTGATCT GATGAACTCG GGGTCGGCGG CGTTCTTCGG TTTCTCCGCT CACTTGCTCC CGCCGTTGGC GAAAATCCGG
TTCTTCGGAT CGAGTTGCGG TCGCCTGGGT GTTTTTCATC AGTTTTGGGT GAAAATACTC GAGCTCTGAG GGGGGTGATT
GGTTTCCAAG TTTGATTGAT TTAAAGAGTT TGTGTGGAAT TTTTTCGGGG AGATGAAGGG GAGGATTTGC TGCGACGGTC
CAGGTTTTGG TTAGTTGTTG AGGGAGAAAA AAATGGAAGA TATTTCTGGG CGCAAGAGAG GAAGGCAGGT GTTTGCTGCT
GCTGCTGGGA GCATGATGGG AAGCTGACCA GCAGCTTCTC CGGTATCCTG GTGCGGCGGA GTTTCGTGCT CTTTGGCGAC
GGGTGCACTG GTGATTGGAG ATGAAGCTCT CTCCGCCGGC GTCGGCGGAT ATGCCGCAGG CCTTGCCGGA GAACGACGGT
ATATATCCTT GCTCACAATT TCGACATTGT TTCAGTTCTG CACTTTCTCA GCTTGTGTTG ATGCCTGCAT TGTAAAGTGG
ATTATGGATC ATGGAGCTTT GTGATTCTGC ACTTTGAGTT GTTTGTGCAT GATTACATAA TGCATAAATG AGTCTCCATT
GCTGCCTTGC ACACACTCCG CACATACACA CACAAAGAAA AAAGAAAGAA AAAAAAAGAA CTACTCCTAC ATTACTTGGC
TCTGTTCATT GCCCTCATGT TATAACATTA TTTGATACTG ACTGAACCTC CTACTGTCTG TGGGCAAGTA CAAATAGTAG
CTTCACATGA ACTTAACTTT CTGGTGGTTT GCTGTTCAGC TCATGTGTGT TTGGCATGTT GCAGGGGAAC AAAGATGTCT
GAACTCGGAG CTGTGGCATG CATGCGCTGG GCCCCTTGTG TCTTTGCCAG TGGTCAGGAG CAGGGTCGTC TACTTTCCAC
AGGGCCATAG CGAGCAGGTC AGTCACTTGG TTTGTAGTCT GTGCACATCT CTTTCATTAT GCTAGGCATG GCCGGATTTT
GTTGACTCGA ATTTACTAGA ATTTATAAAA GAAGGTAGAA CAGCTCTGCT TTTGCATTTG TGCATCAGTA CATAATAGGG
CAGAGGATTG TCTTTATTGT TTGCTCAGTG CATCATTAAA CTTAATATGG CAGAAGAATG AACTGAAACT GTACTGTCTA
AAGTAATTTT AGTTCTGTGC AGGTTGCGGC ATCAACTAAT AAGGAAGTTG ATGCTCAAAT CCCAAATTAT CCAAACTTAC
CTCCTCAGTT AATCTGCCAG CTTCATAATG TCACCATGCA TGTGAGTTCA CTCTTAAAGA AACCATCATG TAGCTTCTTA
ATAAGCAGCT TATGATAATT CACCTGGTGC TTTTGCAGGC TGATGCAGAG ACAGATGAAG TTTATGCTCA GATGACATTG
CAACCATTGA GCCCGGTATT TGACCACTGC TTTGCACTTC TAGCCTTATT TCTTTTAAAA GGGCAAAGAT GTTACAAGGA
TTATGTATTT GTCATGTAAT CCTGTTGACA GGAAGAGCAA AAGGAGCCTT TCCTTCCAAT GGAGTTGGGT GCTGCTAGCA
AGCAACCCAC TAATTACTTC TGCAAGACAT TGACTGCAAG TGACACGAGC ACTCATGGTG GTTTCTCTGT TCCCCGCCGG
GCAGCTGAGA AAGTCTTCCC TCCACTAGTA TGCCTTTAAG CTCAGTCTTT TTTTTGGTAG GAAATGTTCA TTTGCTATGT
GTTCTTCAAA TTGACTCCTT TAGTTCTCTG TAGGATTTTT CACAGCAGCC TCCGGCACAG GAGCTGATTG CAAGAGATTT
GCATGATAAT GAATGGAAAT TTCGCCATAT ATTTCGTGGT ATGTAACTAT GGCCGACACA CATAGAACTG ATTATGAGTT
GTTTGTGTAC ACAAAAAAAT TGACATAAAA TCATGTACTA TGCCTTTTAG ATAGCATTTC CATTAGACAT GACATCTATC
CGTTTTGCTC TTTTTTCTTT GTTGCCAAGA TCTGTTTTTG CATTTTTATC TGGCTAAGAA ATTACCTGGA CATGCTATAA
TGACAATACT GCAACTAGCC TCCTTCTGTT CCTGCCTTGC AGAATTGTTG AATTATGAAA TTATATTGTG AGGGTATCTT
CTTCTATTGA ACTTTCAATT GGCTATGCAT TTGTCGTGCA GGTCAGCCTA AAAGGCATCT CCTGACAACA GGCTGGAGTG
TGTTTGTGAG TGCGAAAAGA CTAGTAGCAG GAGACTCTGT TATATTTATC TGGTACCACC CACTTTATTC CTTATTTAAA
TTGTATACTG TTGCTAGAGG TTGTACTCAT TGCTGAGACT TAATTACCTT TATCATTTTT ACCAGGAATG ATAACAATCA
ACTTCTTTTG GGAATACGTC GTGCAAATCG CCAACAGACT GTTATGCCCT CTTCCGTGTT GTCAAGCGAT AGCATGCATA
TAGGTCTTCT TGCAGCAGCA GCTCATGCTG CAGCCACAAA TAGTCGCTTC ACTATTTTCT ATAACCCCAG GTAAATGTAC
TGCAATCTTA CAGCAGAGCC TTTAACGTTT TATTTTATTT CCATATTTAA TTGACATGGG CATCCTTTTT CAGGGCTAGC
CCTTCTGAAT TTGTGATTCC ATTGGCCAAG TATGTGAAAG CTGTTTACCA CACACGTGTA TCTGTTGGAA TGCGTTTTAG
AATGCTTTTC GAGACAGAGG AGTCAAGTGT CAGGCGGTAA GCTGATATTA AGCACACAGC ATGAACCGTG AAAGCTCCAT
TAATTCTTAT ATTTACCTCT TACTTTCAGA TACATGGGTA CAATCACCAG CATAAGTGAT CTAGATTCAG TGCGCTGGCC
AAACTCACAC TGGCGTTCTG TTAAGGTAAT ATCTGCTAAA TATATTTTGT GGTCTCTACA GAAATGATGT TATCTTGTTC
CATTATCTAG TAGTCTGTCA AATCTGTTAT CACATCCCTC ATGGATCCCT TTCTGTGGAT ATGTTTTCCT TGTGATTTTT
TTTTCATTTT GGATTTATGG CACATTAGGT TGGTTGGGAT GAGTCCACCA CTGGTGATAA ACAGCCAAGG GTTTCTCTTT
GGGAGATTGA GCCTTTGACA ACCTTTCCGA TGTACCCCAG TGCTTTTCCT TTAAGACTTA AGCGTCCGTG GGCTTCAGGA
CTGCCTATGC ATGGCATGTT CAATGGTATG CTGATTGATG GCCGGAACAC TAGCACGCAT AATTCTAAGA GCATACTCTT
TAACCACTTC TTTTTCTGCA GGTGGGGGAA ATGACGATTT TGCACGCTAT TCTTCTCTCA TGTGGCTTCG AGACGGAAAT
AGAGGAACCC AGTCCCTGAA TTTTCAAGGA CATGGAGTCT CACCATGGCT TCAGCCAAGA ATAGATTCTC CATTGCTGGG
CCTTAAGCCA GACACGTACC AGCAAATGGC TGCAGCAGCA CTGGAAGAAA TTCGATATGG GGACCCTTCA AAGCAGCATC
CAGCTACTCT GCAATACCAA CAGACTCATA ATCTGAACAG TGGATTAAAT TCTCTGTTTG CAAGCCATGT TCTAGGGCAG
GTGCAGTTTC AACCTCAGCA GTCACCCCTG CAAGTTGTTC AGCAAGGCCA TTGTCAGAAC ACTGGTGACT CTGGGTTCCT
TCAAGGTCAG CTTCCACGGC TGCAGTTGCA TAACACTCAG CAGCTGCTAA AGGAGCAAGA GTTGCAGCAG CAGCAAAGAC
AGCATGTTTT ACAAGAGCAA TCTAGTCAAG AGATGCAACA GCAGCTCCCA TCTAGTGATC ATCATGTTGC TGATGTAGCT
TCTGAGTCTG GATCTGCTCC TCAGGCACAA TCATCATTGC TTAGTGGATC ATCATTCTAC AATCAGAACC TCTTAGAAGG
AAATAGTGAT CCCCCTTTAC ATCTACACAA CAATTTCCAC AACTTCTCTA ACCAGGAAGC CTCAAACCTT CTTATTTTGC
CTCGAAGTAG CCAATTAATG GCATCAGATG GGTGGCCTTC AAAGCGATTA ACTTTAGAAT CTGCTGTTCA TCCTGAAGCT
CCGTCCATGC ACCCCAAGAT TGAGAAAGTA AATCACCAGG GTATATCTCA TTTTCCTGGC GCCTTTCCAC CACAATCAGC
AAGAGGCTGT TCCATCGTCC AGGATTGCAG GGCAGATGCT GAGAACCGCC TACTTTCATC ATCATTTGAA CTCCAGGATG
GCATGACAAG CATCATAACT GATGCTAACA GAGAAACTGA TACTATGGCC ATACCTTTGT TGAGATATAG TGGTGCAGAT
TTGACAACTG AAAACACCTT AGCAACCTCC AATTGTTTAG GTGAATCTGG AACGTTCAAT CCTCTTAATA ACATATCTGT
AAATCCATCA CAAGGAGCAA CCTTTGTGAA GGTATGCATT TTCAACTTGT GTGTTAGCTT GCGTTAATTC TTCTCTCTGC
ATTTCTTTTT TCAATTTTCA CTGATTGCGA ACATTGGTCG CTAAAAGTAC TTTACTTAGT AGATAAATAA CAAACATTTT
AGTAGGTTGA TGGTAGCAAA GGAGGCAATT ATTTTTTAAA GTTTTGTATG AAGTTTGGAA ATGCCTGTTT CTCTTCTTTT
TACTACCCTA CTTAACATGT CTGTGAGTGT GAGCTGCTCA TTTATTCTAT ATGATCTGGC TAATATCTTC TGCATTTTCT
TCAATAGGTT TACAAATCAG GGTCCCTTGG GAGATCACTT GACATCTCCA GATTCAGCAG CTACTGCGAG TTACGTAGTG
AGCTTGAGCG TCTCTTTGGT CTTGAAGGCC AACTGGAGGA CCCTGTAAGA TCAGGCTGGC AGCTTGTATT TGTCGACCGG
GAAAATGACA TTCTTCTCGT CGGCGACGAT CCATGGCAGT AAGCACTTAC AAACCTAAAA TGTTTCGTAT GCAAACACAA
TATTTGTCAA TGTTCAAAGC AAACAAACAT GATATTCTAT GCCATCTTTT TTTTTCAGGG AGTTTGCAAA TAGCGTATGG
TGCATCAAAA TACTCTCGCC ACAGGAGGTG CAGCAGTTGG TTCGTGGTGG AGACGGCCTT CTGTCCTCAC CTGGAGCAAG
GATGCAGCAG AGCAATGCCT GCGACGACTA TTCTGCAAGC CACAACATGC AGAATATCGC CGGAAACATT GCATCTGTAG
CGCCTCTGGA CTACTGAGAT GTAGACCAGA ATCCAAACTA AGCACCCTTA AGACTGCAGG GTCACCATTC GTGATCGCCT
GCATTCCATG CGATCTTCAC TAGTCCTGTC CGAATCAGTA GCAACTCAGT CAATAATATA GCTAGATGAT CCGTTGTATT
CCATCTGATC ATGGACATGC TGTATGATAG CTGCTTTAGC TCTATTAAAT CTCTAATGGC AGGCAACTAG GCAAGAACAG
TTCTATGATG AATGATGGCA GTCGCTGTAG AATTGACCTT ATTCTGTAGC TATAATATGA TGTCTAGAAC TGATGATTCC
AATTTCCAAA TGGAGCCCGG AACATATTAA AATCAATCAT TTGTCGCCTT CTTC

Locus: Os12g0613700

Loading...

Locus: Os12g0613700

Loading...