Os12t0613700-02

Locus

Os12g0613700

Description

Similar to Auxin response factor 25.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ARF6B

CGSNL Gene Name

AUXIN RESPONSE FACTOR 6B

Oryzabase Gene Symbol Synonym(s)

OsARF6b, OsARF25, ARF25

Oryzabase Gene Name Synonym(s)

auxin response factor-6B, auxin response factor 6B, auxin response factor-25, auxin response factor 25

Transcript Evidence

AK065025 (DDBJ, Best hit)

Protein Evidence

Q2QM84 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

DNA-binding pseudobarrel domain (IPR015300)

Full-length cDNA

J013001G10 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0613700-02)

RiceXPro (AK065025)

Others

Oryzabase (9993)

KEGG (Os12t0613700-02)

Transcript

3836 bp

>Os12t0613700-02 Similar to Auxin response factor 25.
AAAAAAAAAACTCGACCACCACCTCCACCACTCACACCTCGATCCGGCCATGGCGGCCTA
GCCCTAGCACCTAGGGTTCGCGCCCCCACCACCCTCCCCGCCGTCTCGGAGACCGCGCGC
CCCCAGCTCCCGCCTCGCTGTCGCGCCGCCTGATTCCGCCGCCGGCGCCGAATGCTACGC
CGTTTggtggtggtggtggtcgtcgtcgcctgattccgcgatctcgtgagctccgggggg
tgcgcggttgcggcggcggcgcctgagaggaaggctggactcgtccgcggcggcggcggc
tgcgGGCTAGTGTCGGTGGCGATTTGAGGGCGGCGGTTTGGGTTAGCCGTCGCCGAGAGT
GAAGGTGCTGTGTTTTGAGTGCTTGGGATGAGCTGCGTGTTGATCTGATGAACTCGGGGT
CGGCGGCGTTCTTCGGTTTCTCCGCTCACTTGCTCCCGCCGTTGGCGAAAATCCGGTTCT
TCGGATCGAGTTGCGGTCGCCTGGGTGTTTTTCATCAGTTTTGGGTGAAAATACTCGAGC
TCTGAGGGGGGTGATTGGTTTCCAAGTTTGATTGATTTAAAGAGTTTGTGTGGAATTTTT
TCGGGGAGATGAAGGGGAGGATTTGCTGCGACGGTCCAGGTTTTGGTTAGTTGTTGAGGG
AGAAAAAAATGGAAGATATTTCTGGGCGCAAGAGAGGAAGGCAGGTGTTTGCTGCTGCTG
CTGGGAGCATGATGGGAAGCTGACCAGCAGCTTCTCCGGTATCCTGGTGCGGCGGAGTTT
CGTGCTCTTTGGCGACGGGTGCACTGGTGATTGGAGATGAAGCTCTCTCCGCCGGCGTCG
GCGGATATGCCGCAGGCCTTGCCGGAGAACGACGGGGAACAAAGATGTCTGAACTCGGAG
CTGTGGCATGCATGCGCTGGGCCCCTTGTGTCTTTGCCAGTGGTCAGGAGCAGGGTCGTC
TACTTTCCACAGGGCCATAGCGAGCAGGTTGCGGCATCAACTAATAAGGAAGTTGATGCT
CAAATCCCAAATTATCCAAACTTACCTCCTCAGTTAATCTGCCAGCTTCATAATGTCACC
ATGCATGCTGATGCAGAGACAGATGAAGTTTATGCTCAGATGACATTGCAACCATTGAGC
CCGGAAGAGCAAAAGGAGCCTTTCCTTCCAATGGAGTTGGGTGCTGCTAGCAAGCAACCC
ACTAATTACTTCTGCAAGACATTGACTGCAAGTGACACGAGCACTCATGGTGGTTTCTCT
GTTCCCCGCCGGGCAGCTGAGAAAGTCTTCCCTCCACTATTCTCTGTAGGATTTTTCACA
GCAGCCTCCGGCACAGGAGCTGATTGCAAGAGATTTGCATGATAATGAATGGAAATTTCG
CCATATATTTCGTGGTCAGCCTAAAAGGCATCTCCTGACAACAGGCTGGAGTGTGTTTGT
GAGTGCGAAAAGACTAGTAGCAGGAGACTCTGTTATATTTATCTGGAATGATAACAATCA
ACTTCTTTTGGGAATACGTCGTGCAAATCGCCAACAGACTGTTATGCCCTCTTCCGTGTT
GTCAAGCGATAGCATGCATATAGGTCTTCTTGCAGCAGCAGCTCATGCTGCAGCCACAAA
TAGTCGCTTCACTATTTTCTATAACCCCAGGGCTAGCCCTTCTGAATTTGTGATTCCATT
GGCCAAGTATGTGAAAGCTGTTTACCACACACGTGTATCTGTTGGAATGCGTTTTAGAAT
GCTTTTCGAGACAGAGGAGTCAAGTGTCAGGCGATACATGGGTACAATCACCAGCATAAG
TGATCTAGATTCAGTGCGCTGGCCAAACTCACACTGGCGTTCTGTTAAGGTTGGTTGGGA
TGAGTCCACCACTGGTGATAAACAGCCAAGGGTTTCTCTTTGGGAGATTGAGCCTTTGAC
AACCTTTCCGATGTACCCCAGTGCTTTTCCTTTAAGACTTAAGCGTCCGTGGGCTTCAGG
ACTGCCTATGCATGGCATGTTCAATGGTGGGGGAAATGACGATTTTGCACGCTATTCTTC
TCTCATGTGGCTTCGAGACGGAAATAGAGGAACCCAGTCCCTGAATTTTCAAGGACATGG
AGTCTCACCATGGCTTCAGCCAAGAATAGATTCTCCATTGCTGGGCCTTAAGCCAGACAC
GTACCAGCAAATGGCTGCAGCAGCACTGGAAGAAATTCGATATGGGGACCCTTCAAAGCA
GCATCCAGCTACTCTGCAATACCAACAGACTCATAATCTGAACAGTGGATTAAATTCTCT
GTTTGCAAGCCATGTTCTAGGGCAGGTGCAGTTTCAACCTCAGCAGTCACCCCTGCAAGT
TGTTCAGCAAGGCCATTGTCAGAACACTGGTGACTCTGGGTTCCTTCAAGGTCAGCTTCC
ACGGCTGCAGTTGCATAACACTCAGCAGCTGCTAAAGGAGCAAGAGTTGCAGCAGCAGCA
AAGACAGCATGTTTTACAAGAGCAATCTAGTCAAGAGATGCAACAGCAGCTCCCATCTAG
TGATCATCATGTTGCTGATGTAGCTTCTGAGTCTGGATCTGCTCCTCAGGCACAATCATC
ATTGCTTAGTGGATCATCATTCTACAATCAGAACCTCTTAGAAGGAAATAGTGATCCCCC
TTTACATCTACACAACAATTTCCACAACTTCTCTAACCAGGAAGCCTCAAACCTTCTTAT
TTTGCCTCGAAGTAGCCAATTAATGGCATCAGATGGGTGGCCTTCAAAGCGATTAACTTT
AGAATCTGCTGTTCATCCTGAAGCTCCGTCCATGCACCCCAAGATTGAGAAAGTAAATCA
CCAGGGTATATCTCATTTTCCTGGCGCCTTTCCACCACAATCAGCAAGAGGCTGTTCCAT
CGTCCAGGATTGCAGGGCAGATGCTGAGAACCGCCTACTTTCATCATCATTTGAACTCCA
GGATGGCATGACAAGCATCATAACTGATGCTAACAGAGAAACTGATACTATGGCCATACC
TTTGTTGAGATATAGTGGTGCAGATTTGACAACTGAAAACACCTTAGCAACCTCCAATTG
TTTAGGTGAATCTGGAACGTTCAATCCTCTTAATAACATATCTGTAAATCCATCACAAGG
AGCAACCTTTGTGAAGGTTTACAAATCAGGGTCCCTTGGGAGATCACTTGACATCTCCAG
ATTCAGCAGCTACTGCGAGTTACGTAGTGAGCTTGAGCGTCTCTTTGGTCTTGAAGGCCA
ACTGGAGGACCCTGTAAGATCAGGCTGGCAGCTTGTATTTGTCGACCGGGAAAATGACAT
TCTTCTCGTCGGCGACGATCCATGGCAGGAGTTTGCAAATAGCGTATGGTGCATCAAAAT
ACTCTCGCCACAGGAGGTGCAGCAGTTGGTTCGTGGTGGAGACGGCCTTCTGTCCTCACC
TGGAGCAAGGATGCAGCAGAGCAATGCCTGCGACGACTATTCTGCAAGCCACAACATGCA
GAATATCGCCGGAAACATTGCATCTGTAGCGCCTCTGGACTACTGAGATGTAGACCAGAA
TCCAAACTAAGCACCCTTAAGACTGCAGGGTCACCATTCGTGATCGCCTGCATTCCATGC
GATCTTCACTAGTCCTGTCCGAATCAGTAGCAACTCAGTCAATAATATAGCTAGATGATC
CGTTGTATTCCATCTGATCATGGACATGCTGTATGATAGCTGCTTTAGCTCTATTAAATC
TCTAATGGCAGGCAACTAGGCAAGAACAGTTCTATGATGAATGATGGCAGTCGCTGTAGA
ATTGACCTTATTCTGTAGCTATAATATGATGTCTAGAACTGATGATTCCAATTTCC

CDS

546 bp

>Os12t0613700-02 Similar to Auxin response factor 25.
ATGAAGCTCTCTCCGCCGGCGTCGGCGGATATGCCGCAGGCCTTGCCGGAGAACGACGGG
GAACAAAGATGTCTGAACTCGGAGCTGTGGCATGCATGCGCTGGGCCCCTTGTGTCTTTG
CCAGTGGTCAGGAGCAGGGTCGTCTACTTTCCACAGGGCCATAGCGAGCAGGTTGCGGCA
TCAACTAATAAGGAAGTTGATGCTCAAATCCCAAATTATCCAAACTTACCTCCTCAGTTA
ATCTGCCAGCTTCATAATGTCACCATGCATGCTGATGCAGAGACAGATGAAGTTTATGCT
CAGATGACATTGCAACCATTGAGCCCGGAAGAGCAAAAGGAGCCTTTCCTTCCAATGGAG
TTGGGTGCTGCTAGCAAGCAACCCACTAATTACTTCTGCAAGACATTGACTGCAAGTGAC
ACGAGCACTCATGGTGGTTTCTCTGTTCCCCGCCGGGCAGCTGAGAAAGTCTTCCCTCCA
CTATTCTCTGTAGGATTTTTCACAGCAGCCTCCGGCACAGGAGCTGATTGCAAGAGATTT
GCATGA

Protein

181 aa

>Os12t0613700-02 Similar to Auxin response factor 25.
MKLSPPASADMPQALPENDGEQRCLNSELWHACAGPLVSLPVVRSRVVYFPQGHSEQVAA
STNKEVDAQIPNYPNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPEEQKEPFLPME
LGAASKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLFSVGFFTAASGTGADCKRF
A*

5'UTR

chr12:26007524..26008339 (- strand) : 816 bp

CDS

chr12:26007466..26007523 (- strand) : 58 bp

chr12:26006967..26007079 (- strand) : 113 bp

chr12:26006623..26006721 (- strand) : 99 bp

chr12:26006489..26006545 (- strand) : 57 bp

chr12:26006237..26006392 (- strand) : 156 bp

chr12:26006098..26006160 (- strand) : 63 bp

3'UTR

chr12:26006066..26006097 (- strand) : 32 bp

chr12:26005652..26005742 (- strand) : 91 bp

chr12:26005394..26005558 (- strand) : 165 bp

chr12:26005188..26005310 (- strand) : 123 bp

chr12:26005039..26005114 (- strand) : 76 bp

chr12:26004719..26004875 (- strand) : 157 bp

chr12:26003513..26004642 (- strand) : 1130 bp

chr12:26003026..26003216 (- strand) : 191 bp

chr12:26002417..26002925 (- strand) : 509 bp

FASTA

>Os12t0613700-02 class=Sequence position=chr12:26002417..26008339 (- strand)
AAAAAAAAAA CTCGACCACC ACCTCCACCA CTCACACCTC GATCCGGCCA TGGCGGCCTA GCCCTAGCAC CTAGGGTTCG
CGCCCCCACC ACCCTCCCCG CCGTCTCGGA GACCGCGCGC CCCCAGCTCC CGCCTCGCTG TCGCGCCGCC TGATTCCGCC
GCCGGCGCCG AATGCTACGC CGTTTggtgg tggtggtggt cgtcgtcgcc tgattccgcg atctcgtgag ctccgggggg
tgcgcggttg cggcggcggc gcctgagagg aaggctggac tcgtccgcgg cggcggcggc tgcgGGCTAG TGTCGGTGGC
GATTTGAGGG CGGCGGTTTG GGTTAGCCGT CGCCGAGAGT GAAGGTGCTG TGTTTTGAGT GCTTGGGATG AGCTGCGTGT
TGATCTGATG AACTCGGGGT CGGCGGCGTT CTTCGGTTTC TCCGCTCACT TGCTCCCGCC GTTGGCGAAA ATCCGGTTCT
TCGGATCGAG TTGCGGTCGC CTGGGTGTTT TTCATCAGTT TTGGGTGAAA ATACTCGAGC TCTGAGGGGG GTGATTGGTT
TCCAAGTTTG ATTGATTTAA AGAGTTTGTG TGGAATTTTT TCGGGGAGAT GAAGGGGAGG ATTTGCTGCG ACGGTCCAGG
TTTTGGTTAG TTGTTGAGGG AGAAAAAAAT GGAAGATATT TCTGGGCGCA AGAGAGGAAG GCAGGTGTTT GCTGCTGCTG
CTGGGAGCAT GATGGGAAGC TGACCAGCAG CTTCTCCGGT ATCCTGGTGC GGCGGAGTTT CGTGCTCTTT GGCGACGGGT
GCACTGGTGA TTGGAGATGA AGCTCTCTCC GCCGGCGTCG GCGGATATGC CGCAGGCCTT GCCGGAGAAC GACGGTATAT
ATCCTTGCTC ACAATTTCGA CATTGTTTCA GTTCTGCACT TTCTCAGCTT GTGTTGATGC CTGCATTGTA AAGTGGATTA
TGGATCATGG AGCTTTGTGA TTCTGCACTT TGAGTTGTTT GTGCATGATT ACATAATGCA TAAATGAGTC TCCATTGCTG
CCTTGCACAC ACTCCGCACA TACACACACA AAGAAAAAAG AAAGAAAAAA AAAGAACTAC TCCTACATTA CTTGGCTCTG
TTCATTGCCC TCATGTTATA ACATTATTTG ATACTGACTG AACCTCCTAC TGTCTGTGGG CAAGTACAAA TAGTAGCTTC
ACATGAACTT AACTTTCTGG TGGTTTGCTG TTCAGCTCAT GTGTGTTTGG CATGTTGCAG GGGAACAAAG ATGTCTGAAC
TCGGAGCTGT GGCATGCATG CGCTGGGCCC CTTGTGTCTT TGCCAGTGGT CAGGAGCAGG GTCGTCTACT TTCCACAGGG
CCATAGCGAG CAGGTCAGTC ACTTGGTTTG TAGTCTGTGC ACATCTCTTT CATTATGCTA GGCATGGCCG GATTTTGTTG
ACTCGAATTT ACTAGAATTT ATAAAAGAAG GTAGAACAGC TCTGCTTTTG CATTTGTGCA TCAGTACATA ATAGGGCAGA
GGATTGTCTT TATTGTTTGC TCAGTGCATC ATTAAACTTA ATATGGCAGA AGAATGAACT GAAACTGTAC TGTCTAAAGT
AATTTTAGTT CTGTGCAGGT TGCGGCATCA ACTAATAAGG AAGTTGATGC TCAAATCCCA AATTATCCAA ACTTACCTCC
TCAGTTAATC TGCCAGCTTC ATAATGTCAC CATGCATGTG AGTTCACTCT TAAAGAAACC ATCATGTAGC TTCTTAATAA
GCAGCTTATG ATAATTCACC TGGTGCTTTT GCAGGCTGAT GCAGAGACAG ATGAAGTTTA TGCTCAGATG ACATTGCAAC
CATTGAGCCC GGTATTTGAC CACTGCTTTG CACTTCTAGC CTTATTTCTT TTAAAAGGGC AAAGATGTTA CAAGGATTAT
GTATTTGTCA TGTAATCCTG TTGACAGGAA GAGCAAAAGG AGCCTTTCCT TCCAATGGAG TTGGGTGCTG CTAGCAAGCA
ACCCACTAAT TACTTCTGCA AGACATTGAC TGCAAGTGAC ACGAGCACTC ATGGTGGTTT CTCTGTTCCC CGCCGGGCAG
CTGAGAAAGT CTTCCCTCCA CTAGTATGCC TTTAAGCTCA GTCTTTTTTT TGGTAGGAAA TGTTCATTTG CTATGTGTTC
TTCAAATTGA CTCCTTTAGT TCTCTGTAGG ATTTTTCACA GCAGCCTCCG GCACAGGAGC TGATTGCAAG AGATTTGCAT
GATAATGAAT GGAAATTTCG CCATATATTT CGTGGTATGT AACTATGGCC GACACACATA GAACTGATTA TGAGTTGTTT
GTGTACACAA AAAAATTGAC ATAAAATCAT GTACTATGCC TTTTAGATAG CATTTCCATT AGACATGACA TCTATCCGTT
TTGCTCTTTT TTCTTTGTTG CCAAGATCTG TTTTTGCATT TTTATCTGGC TAAGAAATTA CCTGGACATG CTATAATGAC
AATACTGCAA CTAGCCTCCT TCTGTTCCTG CCTTGCAGAA TTGTTGAATT ATGAAATTAT ATTGTGAGGG TATCTTCTTC
TATTGAACTT TCAATTGGCT ATGCATTTGT CGTGCAGGTC AGCCTAAAAG GCATCTCCTG ACAACAGGCT GGAGTGTGTT
TGTGAGTGCG AAAAGACTAG TAGCAGGAGA CTCTGTTATA TTTATCTGGT ACCACCCACT TTATTCCTTA TTTAAATTGT
ATACTGTTGC TAGAGGTTGT ACTCATTGCT GAGACTTAAT TACCTTTATC ATTTTTACCA GGAATGATAA CAATCAACTT
CTTTTGGGAA TACGTCGTGC AAATCGCCAA CAGACTGTTA TGCCCTCTTC CGTGTTGTCA AGCGATAGCA TGCATATAGG
TCTTCTTGCA GCAGCAGCTC ATGCTGCAGC CACAAATAGT CGCTTCACTA TTTTCTATAA CCCCAGGTAA ATGTACTGCA
ATCTTACAGC AGAGCCTTTA ACGTTTTATT TTATTTCCAT ATTTAATTGA CATGGGCATC CTTTTTCAGG GCTAGCCCTT
CTGAATTTGT GATTCCATTG GCCAAGTATG TGAAAGCTGT TTACCACACA CGTGTATCTG TTGGAATGCG TTTTAGAATG
CTTTTCGAGA CAGAGGAGTC AAGTGTCAGG CGGTAAGCTG ATATTAAGCA CACAGCATGA ACCGTGAAAG CTCCATTAAT
TCTTATATTT ACCTCTTACT TTCAGATACA TGGGTACAAT CACCAGCATA AGTGATCTAG ATTCAGTGCG CTGGCCAAAC
TCACACTGGC GTTCTGTTAA GGTAATATCT GCTAAATATA TTTTGTGGTC TCTACAGAAA TGATGTTATC TTGTTCCATT
ATCTAGTAGT CTGTCAAATC TGTTATCACA TCCCTCATGG ATCCCTTTCT GTGGATATGT TTTCCTTGTG ATTTTTTTTT
CATTTTGGAT TTATGGCACA TTAGGTTGGT TGGGATGAGT CCACCACTGG TGATAAACAG CCAAGGGTTT CTCTTTGGGA
GATTGAGCCT TTGACAACCT TTCCGATGTA CCCCAGTGCT TTTCCTTTAA GACTTAAGCG TCCGTGGGCT TCAGGACTGC
CTATGCATGG CATGTTCAAT GGTATGCTGA TTGATGGCCG GAACACTAGC ACGCATAATT CTAAGAGCAT ACTCTTTAAC
CACTTCTTTT TCTGCAGGTG GGGGAAATGA CGATTTTGCA CGCTATTCTT CTCTCATGTG GCTTCGAGAC GGAAATAGAG
GAACCCAGTC CCTGAATTTT CAAGGACATG GAGTCTCACC ATGGCTTCAG CCAAGAATAG ATTCTCCATT GCTGGGCCTT
AAGCCAGACA CGTACCAGCA AATGGCTGCA GCAGCACTGG AAGAAATTCG ATATGGGGAC CCTTCAAAGC AGCATCCAGC
TACTCTGCAA TACCAACAGA CTCATAATCT GAACAGTGGA TTAAATTCTC TGTTTGCAAG CCATGTTCTA GGGCAGGTGC
AGTTTCAACC TCAGCAGTCA CCCCTGCAAG TTGTTCAGCA AGGCCATTGT CAGAACACTG GTGACTCTGG GTTCCTTCAA
GGTCAGCTTC CACGGCTGCA GTTGCATAAC ACTCAGCAGC TGCTAAAGGA GCAAGAGTTG CAGCAGCAGC AAAGACAGCA
TGTTTTACAA GAGCAATCTA GTCAAGAGAT GCAACAGCAG CTCCCATCTA GTGATCATCA TGTTGCTGAT GTAGCTTCTG
AGTCTGGATC TGCTCCTCAG GCACAATCAT CATTGCTTAG TGGATCATCA TTCTACAATC AGAACCTCTT AGAAGGAAAT
AGTGATCCCC CTTTACATCT ACACAACAAT TTCCACAACT TCTCTAACCA GGAAGCCTCA AACCTTCTTA TTTTGCCTCG
AAGTAGCCAA TTAATGGCAT CAGATGGGTG GCCTTCAAAG CGATTAACTT TAGAATCTGC TGTTCATCCT GAAGCTCCGT
CCATGCACCC CAAGATTGAG AAAGTAAATC ACCAGGGTAT ATCTCATTTT CCTGGCGCCT TTCCACCACA ATCAGCAAGA
GGCTGTTCCA TCGTCCAGGA TTGCAGGGCA GATGCTGAGA ACCGCCTACT TTCATCATCA TTTGAACTCC AGGATGGCAT
GACAAGCATC ATAACTGATG CTAACAGAGA AACTGATACT ATGGCCATAC CTTTGTTGAG ATATAGTGGT GCAGATTTGA
CAACTGAAAA CACCTTAGCA ACCTCCAATT GTTTAGGTGA ATCTGGAACG TTCAATCCTC TTAATAACAT ATCTGTAAAT
CCATCACAAG GAGCAACCTT TGTGAAGGTA TGCATTTTCA ACTTGTGTGT TAGCTTGCGT TAATTCTTCT CTCTGCATTT
CTTTTTTCAA TTTTCACTGA TTGCGAACAT TGGTCGCTAA AAGTACTTTA CTTAGTAGAT AAATAACAAA CATTTTAGTA
GGTTGATGGT AGCAAAGGAG GCAATTATTT TTTAAAGTTT TGTATGAAGT TTGGAAATGC CTGTTTCTCT TCTTTTTACT
ACCCTACTTA ACATGTCTGT GAGTGTGAGC TGCTCATTTA TTCTATATGA TCTGGCTAAT ATCTTCTGCA TTTTCTTCAA
TAGGTTTACA AATCAGGGTC CCTTGGGAGA TCACTTGACA TCTCCAGATT CAGCAGCTAC TGCGAGTTAC GTAGTGAGCT
TGAGCGTCTC TTTGGTCTTG AAGGCCAACT GGAGGACCCT GTAAGATCAG GCTGGCAGCT TGTATTTGTC GACCGGGAAA
ATGACATTCT TCTCGTCGGC GACGATCCAT GGCAGTAAGC ACTTACAAAC CTAAAATGTT TCGTATGCAA ACACAATATT
TGTCAATGTT CAAAGCAAAC AAACATGATA TTCTATGCCA TCTTTTTTTT TCAGGGAGTT TGCAAATAGC GTATGGTGCA
TCAAAATACT CTCGCCACAG GAGGTGCAGC AGTTGGTTCG TGGTGGAGAC GGCCTTCTGT CCTCACCTGG AGCAAGGATG
CAGCAGAGCA ATGCCTGCGA CGACTATTCT GCAAGCCACA ACATGCAGAA TATCGCCGGA AACATTGCAT CTGTAGCGCC
TCTGGACTAC TGAGATGTAG ACCAGAATCC AAACTAAGCA CCCTTAAGAC TGCAGGGTCA CCATTCGTGA TCGCCTGCAT
TCCATGCGAT CTTCACTAGT CCTGTCCGAA TCAGTAGCAA CTCAGTCAAT AATATAGCTA GATGATCCGT TGTATTCCAT
CTGATCATGG ACATGCTGTA TGATAGCTGC TTTAGCTCTA TTAAATCTCT AATGGCAGGC AACTAGGCAA GAACAGTTCT
ATGATGAATG ATGGCAGTCG CTGTAGAATT GACCTTATTC TGTAGCTATA ATATGATGTC TAGAACTGAT GATTCCAATT
TCC

Locus: Os12g0613700

Loading...

Locus: Os12g0613700

Loading...