Os12t0614600-01

Locus

Os12g0614600

Description

Protein kinase PINOID, Control of polar auxin transport, Regulation of stigma and ovule initiation, Promotion of pistil and stamen development

RAP-DB Gene Symbol Synonym(s)

OsPID

RAP-DB Gene Name Synonym(s)

OsPINOID

CGSNL Gene Symbol

BIF2

CGSNL Gene Name

BARREN INFLORESCENCE 2

Oryzabase Gene Symbol Synonym(s)

bif2, Osbif2, OsBIF2, OsPID

Oryzabase Gene Name Synonym(s)

barren inflorescence2, barren inflorescence2-like serine/threonine protein kinase, rice ortholog of PINOID, OsPINOID

Transcript Evidence

AK106290

Protein Evidence

Q2QM77

Literature

PMID: 30926655

PMID: 30918083

PMID: 17303594

Note

Manual Curation

April 25, 2019

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Protein kinase-like domain superfamily (IPR011009)

Protein kinase domain (IPR000719)

Serine/threonine-protein kinase, active site (IPR008271)

Full-length cDNA

002-101-B02 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0614600-01)

RiceXPro (AK106290)

Others

Oryzabase (7332)

KEGG (Os12t0614600-01 (EC:2.7.11.1))

Transcript

1760 bp

>Os12t0614600-01 Protein kinase PINOID, Control of polar auxin transport, Regulation of stigma and ovule initiation, Promotion of pistil and stamen development
ACTTCACCACCGCACAGCGAGCTCGCCGCGGAGAGCTTTCGCCGGAGAGGTAGACGACGA
CGGCGACGACAGTGTCACGTGCTCACGTTCATGGTGGCGGCGGTGCGCGCGCCGGTGAAG
CCGGAGATGGTGGAGCTCTCGCCGGCGGCGATGGAGAGGTACTCCTCCGACGCCGACACG
ACGGCGCCGAACTCGAGCCTTAGCTCGGCGGCGAGCAGCACGGGGAGCCTCGCGCGGTGC
TCGAGCCTGTCGCGCCTGTCGTTCGACTGCTCGCCGTCGGCCGCCGTGGCGGCGGCGGCG
ACGTCGTGCTCGCCGCCGCGGGCGTCGGTGCTGTTGCGGCCGCACAGGTCCGGCGACGTC
GCGTGGGCGGCCATCCGCGCGGCTTCGACGACCTCCGCGGCGCCGCTAGGCCCGCGGGAC
TTCAAGCTCGTGCGGCGCATCGGCGGCGGCGACATCGGGACGGTGTACCTGTGCCGCCTC
CGGAGCTCGCCGGAGAGGGAGAGCCCGTGCATGTACGCGATGAAGGTGGTGGACCGGAGG
GCGGTGGCGAGGAAGCAGAAGCTGGGGCGCGCGGCGGCGGAGAAGCGGATCCTGCGGCAG
CTGGACCACCCCTTCCTCCCCACCCTCTTCGCCGACTTCGACGCCACGCCGCACTTCTCC
TGCGCCGTCATGGAGTTCTGCCCCGGCGGCGACCTCCACTCCCTCCGCCACCGCATGCCG
TCCCGCCGCTTCCCGCTCCCCTCCGCCCGCTTCTACGCCGCCGAGGTGCTCCTCGCCATC
GAGTACCTCCACATGATGGGCATcgtctaccgcgacctcaagcccgagaacgtcctcatc
cgcgccgacggccacatcatgctcaccgacttcgacctctcgctgcagtccaccacctcg
ccgtctctcgacggcgacaccgacaccgacgacgaggccagcggtggcgcgtcctgcttc
ccggaccacctcctccgGTTCAAGCGGCGGCGGAACGCCGTGGCGGCGCCGCGTCCGCGG
TTCGTGGCGGAGCCGGTGGATGCGAGGTCGTGCTCGTTCGTGGGGACGCACGAGTACGTG
GCCCCCGAGGTGGCGAGCGGCGGCGCGCATGGCGCGGCCGTGGACTGGTGGGCGTACGGG
GTGTTCCTCTACGAGCTCATCTACGGCCGTACGCCGTTCGCCGGCGCTACAAACGAGGCG
ACGCTCCGCAACATCGTCCGCCGCCCGCTCGCCTTCCCCTCCGGCTCCGGCTCGTGCGGT
CCCGCCGACGCCGACGCGCGCGACCTCATCGCCCGCCTCCTCGCCAAGGACCCCGCCGCC
CGCCTCGGCTCCCGCCGCGGCGCCGCCGACGTCAAGTCCCACCCCTTCTTCAAGTCCCTC
AACCTCGCCCTCCTCCGTTCGTCGCGCCCGCCCGTCGTCCCCGGCGCCGGCGCCGGCGCC
GCGCCGCTACACCGGTCGCAGTCGTGCAAGGCGGCGCCGACAACGCCGCCGCCGCCGACG
ACGACGAAGCCGGCGAACGCCACCGCGCGGTTCGACCTCTTCTGAGCATATTGACCGTTG
CTGTCTGCTACTACCTACCCGCGTCGTCGCCGACATCGCCGGCGGGAGACACGCTCCGGC
CACCGTGACATTAATTTCTCGTTGACCCTTAGCTACCGCGTTGAATGTACACACTGTTAA
TTAATTACTACTCCTAGTTAATCACTGCTAATCACCTTGCTGTTAGTACTACTAAACTAA
TATAATCTAGTGGCTTAATT

CDS

1455 bp

>Os12t0614600-01 Protein kinase PINOID, Control of polar auxin transport, Regulation of stigma and ovule initiation, Promotion of pistil and stamen development
ATGGTGGCGGCGGTGCGCGCGCCGGTGAAGCCGGAGATGGTGGAGCTCTCGCCGGCGGCG
ATGGAGAGGTACTCCTCCGACGCCGACACGACGGCGCCGAACTCGAGCCTTAGCTCGGCG
GCGAGCAGCACGGGGAGCCTCGCGCGGTGCTCGAGCCTGTCGCGCCTGTCGTTCGACTGC
TCGCCGTCGGCCGCCGTGGCGGCGGCGGCGACGTCGTGCTCGCCGCCGCGGGCGTCGGTG
CTGTTGCGGCCGCACAGGTCCGGCGACGTCGCGTGGGCGGCCATCCGCGCGGCTTCGACG
ACCTCCGCGGCGCCGCTAGGCCCGCGGGACTTCAAGCTCGTGCGGCGCATCGGCGGCGGC
GACATCGGGACGGTGTACCTGTGCCGCCTCCGGAGCTCGCCGGAGAGGGAGAGCCCGTGC
ATGTACGCGATGAAGGTGGTGGACCGGAGGGCGGTGGCGAGGAAGCAGAAGCTGGGGCGC
GCGGCGGCGGAGAAGCGGATCCTGCGGCAGCTGGACCACCCCTTCCTCCCCACCCTCTTC
GCCGACTTCGACGCCACGCCGCACTTCTCCTGCGCCGTCATGGAGTTCTGCCCCGGCGGC
GACCTCCACTCCCTCCGCCACCGCATGCCGTCCCGCCGCTTCCCGCTCCCCTCCGCCCGC
TTCTACGCCGCCGAGGTGCTCCTCGCCATCGAGTACCTCCACATGATGGGCATcgtctac
cgcgacctcaagcccgagaacgtcctcatccgcgccgacggccacatcatgctcaccgac
ttcgacctctcgctgcagtccaccacctcgccgtctctcgacggcgacaccgacaccgac
gacgaggccagcggtggcgcgtcctgcttcccggaccacctcctccgGTTCAAGCGGCGG
CGGAACGCCGTGGCGGCGCCGCGTCCGCGGTTCGTGGCGGAGCCGGTGGATGCGAGGTCG
TGCTCGTTCGTGGGGACGCACGAGTACGTGGCCCCCGAGGTGGCGAGCGGCGGCGCGCAT
GGCGCGGCCGTGGACTGGTGGGCGTACGGGGTGTTCCTCTACGAGCTCATCTACGGCCGT
ACGCCGTTCGCCGGCGCTACAAACGAGGCGACGCTCCGCAACATCGTCCGCCGCCCGCTC
GCCTTCCCCTCCGGCTCCGGCTCGTGCGGTCCCGCCGACGCCGACGCGCGCGACCTCATC
GCCCGCCTCCTCGCCAAGGACCCCGCCGCCCGCCTCGGCTCCCGCCGCGGCGCCGCCGAC
GTCAAGTCCCACCCCTTCTTCAAGTCCCTCAACCTCGCCCTCCTCCGTTCGTCGCGCCCG
CCCGTCGTCCCCGGCGCCGGCGCCGGCGCCGCGCCGCTACACCGGTCGCAGTCGTGCAAG
GCGGCGCCGACAACGCCGCCGCCGCCGACGACGACGAAGCCGGCGAACGCCACCGCGCGG
TTCGACCTCTTCTGA

Protein

485 aa

>Os12t0614600-01 Protein kinase PINOID, Control of polar auxin transport, Regulation of stigma and ovule initiation, Promotion of pistil and stamen development
MVAAVRAPVKPEMVELSPAAMERYSSDADTTAPNSSLSSAASSTGSLARCSSLSRLSFDC
SPSAAVAAAATSCSPPRASVLLRPHRSGDVAWAAIRAASTTSAAPLGPRDFKLVRRIGGG
DIGTVYLCRLRSSPERESPCMYAMKVVDRRAVARKQKLGRAAAEKRILRQLDHPFLPTLF
ADFDATPHFSCAVMEFCPGGDLHSLRHRMPSRRFPLPSARFYAAEVLLAIEYLHMMGIVY
RDLKPENVLIRADGHIMLTDFDLSLQSTTSPSLDGDTDTDDEASGGASCFPDHLLRFKRR
RNAVAAPRPRFVAEPVDARSCSFVGTHEYVAPEVASGGAHGAAVDWWAYGVFLYELIYGR
TPFAGATNEATLRNIVRRPLAFPSGSGSCGPADADARDLIARLLAKDPAARLGSRRGAAD
VKSHPFFKSLNLALLRSSRPPVVPGAGAGAAPLHRSQSCKAAPTTPPPPTTTKPANATAR
FDLF*

5'UTR

chr12:26055221..26055310 (+ strand) : 90 bp

CDS

chr12:26055311..26056765 (+ strand) : 1455 bp

3'UTR

chr12:26056766..26056980 (+ strand) : 215 bp

FASTA

>Os12t0614600-01 class=Sequence position=chr12:26055221..26056980 (+ strand)
ACTTCACCAC CGCACAGCGA GCTCGCCGCG GAGAGCTTTC GCCGGAGAGG TAGACGACGA CGGCGACGAC AGTGTCACGT
GCTCACGTTC ATGGTGGCGG CGGTGCGCGC GCCGGTGAAG CCGGAGATGG TGGAGCTCTC GCCGGCGGCG ATGGAGAGGT
ACTCCTCCGA CGCCGACACG ACGGCGCCGA ACTCGAGCCT TAGCTCGGCG GCGAGCAGCA CGGGGAGCCT CGCGCGGTGC
TCGAGCCTGT CGCGCCTGTC GTTCGACTGC TCGCCGTCGG CCGCCGTGGC GGCGGCGGCG ACGTCGTGCT CGCCGCCGCG
GGCGTCGGTG CTGTTGCGGC CGCACAGGTC CGGCGACGTC GCGTGGGCGG CCATCCGCGC GGCTTCGACG ACCTCCGCGG
CGCCGCTAGG CCCGCGGGAC TTCAAGCTCG TGCGGCGCAT CGGCGGCGGC GACATCGGGA CGGTGTACCT GTGCCGCCTC
CGGAGCTCGC CGGAGAGGGA GAGCCCGTGC ATGTACGCGA TGAAGGTGGT GGACCGGAGG GCGGTGGCGA GGAAGCAGAA
GCTGGGGCGC GCGGCGGCGG AGAAGCGGAT CCTGCGGCAG CTGGACCACC CCTTCCTCCC CACCCTCTTC GCCGACTTCG
ACGCCACGCC GCACTTCTCC TGCGCCGTCA TGGAGTTCTG CCCCGGCGGC GACCTCCACT CCCTCCGCCA CCGCATGCCG
TCCCGCCGCT TCCCGCTCCC CTCCGCCCGC TTCTACGCCG CCGAGGTGCT CCTCGCCATC GAGTACCTCC ACATGATGGG
CATcgtctac cgcgacctca agcccgagaa cgtcctcatc cgcgccgacg gccacatcat gctcaccgac ttcgacctct
cgctgcagtc caccacctcg ccgtctctcg acggcgacac cgacaccgac gacgaggcca gcggtggcgc gtcctgcttc
ccggaccacc tcctccgGTT CAAGCGGCGG CGGAACGCCG TGGCGGCGCC GCGTCCGCGG TTCGTGGCGG AGCCGGTGGA
TGCGAGGTCG TGCTCGTTCG TGGGGACGCA CGAGTACGTG GCCCCCGAGG TGGCGAGCGG CGGCGCGCAT GGCGCGGCCG
TGGACTGGTG GGCGTACGGG GTGTTCCTCT ACGAGCTCAT CTACGGCCGT ACGCCGTTCG CCGGCGCTAC AAACGAGGCG
ACGCTCCGCA ACATCGTCCG CCGCCCGCTC GCCTTCCCCT CCGGCTCCGG CTCGTGCGGT CCCGCCGACG CCGACGCGCG
CGACCTCATC GCCCGCCTCC TCGCCAAGGA CCCCGCCGCC CGCCTCGGCT CCCGCCGCGG CGCCGCCGAC GTCAAGTCCC
ACCCCTTCTT CAAGTCCCTC AACCTCGCCC TCCTCCGTTC GTCGCGCCCG CCCGTCGTCC CCGGCGCCGG CGCCGGCGCC
GCGCCGCTAC ACCGGTCGCA GTCGTGCAAG GCGGCGCCGA CAACGCCGCC GCCGCCGACG ACGACGAAGC CGGCGAACGC
CACCGCGCGG TTCGACCTCT TCTGAGCATA TTGACCGTTG CTGTCTGCTA CTACCTACCC GCGTCGTCGC CGACATCGCC
GGCGGGAGAC ACGCTCCGGC CACCGTGACA TTAATTTCTC GTTGACCCTT AGCTACCGCG TTGAATGTAC ACACTGTTAA
TTAATTACTA CTCCTAGTTA ATCACTGCTA ATCACCTTGC TGTTAGTACT ACTAAACTAA TATAATCTAG TGGCTTAATT