Os12t0615900-01

Locus

Os12g0615900

Description

WD40/YVTN repeat-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsWD40-200

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK107784 (DDBJ, Best hit)

Protein Evidence

B6TGY8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

WD40 repeat (IPR001680)

WD40 repeat-like-containing domain (IPR011046)

WD40/YVTN repeat-like-containing domain (IPR015943)

WD40-repeat-containing domain (IPR017986)

WD40 repeat, conserved site (IPR019775)

WD40 repeat, subgroup (IPR019781)

WD40 repeat 2 (IPR019782)

Full-length cDNA

002-133-C10 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0615900-01)

RiceXPro (AK107784)

Others

Oryzabase (10881)

KEGG (Os12t0615900-01)

Transcript

1009 bp

>Os12t0615900-01 WD40/YVTN repeat-like domain containing protein.
ccgccgacctcggcccgctcctcgaccccgccgcgccggtctccgccctcgccatccact
ccctcggccccgtcccgcgcaacctcctcgccgcctccgacgacggcctcctccacctct
acgacgccggcgaggggttcccgctcctcgcctcgctccgcgtcttcccgcgccaccgcg
agcccgccgacgccctcgccgtgcaccccacggggcgtgtcgcgctcgccgtcggccgct
cggggggcctcgccATGCTCAACCTCCTCCGCGGCCGCCGCAGCTTCTCCTGCCGCCTCG
AGCACCCGGCCACGGCGATCGCCTACGCCGAGGATGGCGCCGGTGGGGACCGCTTCGTGA
TGGCCGCCGAGGAGAAGGTGACCGTGCACGACTCCGAGGATGCTAGGATCATCCATGAGA
TCGACTGCGGCAAAAGGGTGCTCGCCTTTGCGCCTGCAAAGAAGGGAATACTTTACACTG
GAGGAGAGGAACGCGGTATTACTGCTTGGGATCTTTCCAGTGGCAAGGTTACATCACGCA
TTGAGGATGCTCATTCAACTCGTGTGAAAGGGATTGTTGTCTTCGACGACAAGAACGATG
GATCTGAACTGTGCAACCTAATTGCTTCGGCCTCATCAGATGGTATAATAAGGATCTGGG
ATGCTCGGATGATTGCAAAAGAGAAGACTACTCCATTAGCAGAGGCTAACACAAAAGCAA
GGCTGACTTGTCTTGCGGGATCATCATTGAATTGAGCTAAGGAAAGCAGAAATGAAGCGG
ACGTGGAGCTAAATTGTTGAATTGAGGCCGTGGTACCAATTTTGTACTCTTTAGTTTTTA
GTCTAGTCTCTATAACATATTTGTGTTGGAGAAACAAACCGAGGAGCTCGATGTATGGGA
CATGTATGATAGCCATAAGTTATGCATCACCATAGTCTGGCTTGAGGGCCTAAACTGCTT
AATGTTTATGCAAGCGCATGGTTCTATTGTATCACCAGTTTTCTATACC

CDS

753 bp

>Os12t0615900-01 WD40/YVTN repeat-like domain containing protein.
gccgacctcggcccgctcctcgaccccgccgcgccggtctccgccctcgccatccactcc
ctcggccccgtcccgcgcaacctcctcgccgcctccgacgacggcctcctccacctctac
gacgccggcgaggggttcccgctcctcgcctcgctccgcgtcttcccgcgccaccgcgag
cccgccgacgccctcgccgtgcaccccacggggcgtgtcgcgctcgccgtcggccgctcg
gggggcctcgccATGCTCAACCTCCTCCGCGGCCGCCGCAGCTTCTCCTGCCGCCTCGAG
CACCCGGCCACGGCGATCGCCTACGCCGAGGATGGCGCCGGTGGGGACCGCTTCGTGATG
GCCGCCGAGGAGAAGGTGACCGTGCACGACTCCGAGGATGCTAGGATCATCCATGAGATC
GACTGCGGCAAAAGGGTGCTCGCCTTTGCGCCTGCAAAGAAGGGAATACTTTACACTGGA
GGAGAGGAACGCGGTATTACTGCTTGGGATCTTTCCAGTGGCAAGGTTACATCACGCATT
GAGGATGCTCATTCAACTCGTGTGAAAGGGATTGTTGTCTTCGACGACAAGAACGATGGA
TCTGAACTGTGCAACCTAATTGCTTCGGCCTCATCAGATGGTATAATAAGGATCTGGGAT
GCTCGGATGATTGCAAAAGAGAAGACTACTCCATTAGCAGAGGCTAACACAAAAGCAAGG
CTGACTTGTCTTGCGGGATCATCATTGAATTGA

Protein

251 aa

>Os12t0615900-01 WD40/YVTN repeat-like domain containing protein.
ADLGPLLDPAAPVSALAIHSLGPVPRNLLAASDDGLLHLYDAGEGFPLLASLRVFPRHRE
PADALAVHPTGRVALAVGRSGGLAMLNLLRGRRSFSCRLEHPATAIAYAEDGAGGDRFVM
AAEEKVTVHDSEDARIIHEIDCGKRVLAFAPAKKGILYTGGEERGITAWDLSSGKVTSRI
EDAHSTRVKGIVVFDDKNDGSELCNLIASASSDGIIRIWDARMIAKEKTTPLAEANTKAR
LTCLAGSSLN*

5'UTR

chr12:26128861..26128862 (+ strand) : 2 bp

CDS

chr12:26128863..26129321 (+ strand) : 459 bp

chr12:26129707..26129998 (+ strand) : 292 bp

chr12:26130488..26130489 (+ strand) : 2 bp

3'UTR

chr12:26130490..26130743 (+ strand) : 254 bp

FASTA

>Os12t0615900-01 class=Sequence position=chr12:26128861..26130743 (+ strand)
ccgccgacct cggcccgctc ctcgaccccg ccgcgccggt ctccgccctc gccatccact ccctcggccc cgtcccgcgc
aacctcctcg ccgcctccga cgacggcctc ctccacctct acgacgccgg cgaggggttc ccgctcctcg cctcgctccg
cgtcttcccg cgccaccgcg agcccgccga cgccctcgcc gtgcacccca cggggcgtgt cgcgctcgcc gtcggccgct
cggggggcct cgccATGCTC AACCTCCTCC GCGGCCGCCG CAGCTTCTCC TGCCGCCTCG AGCACCCGGC CACGGCGATC
GCCTACGCCG AGGATGGCGC CGGTGGGGAC CGCTTCGTGA TGGCCGCCGA GGAGAAGGTG ACCGTGCACG ACTCCGAGGA
TGCTAGGATC ATCCATGAGA TCGACTGCGG CAAAAGGGTG CTCGCCTTTG CGCCTGCAAA GGTATTGCCA TTCACCACCA
AGATAATCTC TCCCACACAC TCATTGTTGT AAGGATGGCT AGTTGCTTAT GAGTTGTGGT TGCTAAATGG TTAGGCATAA
ATGCTAGTAG TTTACAGTGT AGGTGCTGAG TATTTGATGA AATTTGTCAT ATTGTTCAAT GTGTCGGCTT TTGATTGATT
ATATTGTTAC CGATATTGTG GTGAATTAGC TATCATTTGG AGCTCCAGTC CATGCTATTC TTTTAGCTAT CTGGAGCTGA
TCATTTCGCT TTATGCATGA GGATTGAGGT TAATCTTTGG ATGCTATAGA TATTATAGAA ACATTGAGTG ACTATATGGT
GTTGCCTTTT GTATACCGCT CACTTGTTTA TGATTTAATT TGTTAGAAGG GAATACTTTA CACTGGAGGA GAGGAACGCG
GTATTACTGC TTGGGATCTT TCCAGTGGCA AGGTTACATC ACGCATTGAG GATGCTCATT CAACTCGTGT GAAAGGGATT
GTTGTCTTCG ACGACAAGAA CGATGGATCT GAACTGTGCA ACCTAATTGC TTCGGCCTCA TCAGATGGTA TAATAAGGAT
CTGGGATGCT CGGATGATTG CAAAAGAGAA GACTACTCCA TTAGCAGAGG CTAACACAAA AGCAAGGCTG ACTTGTCTTG
CGGGATCATC ATTGAATTGT AAGTCCACGG AATATTCATC CTGTTGTTGT GTCGTCTATC AATGTCCAAT GGAGGCTAAC
GTTGCTTATT GCTATTGACT GAAAAGAACT AACCATGATG GTTATACCTG CTTTTTCCAC AGTCGATGGT TTGATTAAAA
TTGACATTTT ATTTATTTAA ATCAATCTAT TCGGAGTGCA TCCATACGTC AAATGTCTTC TTTTTCTATG AGATGGATGG
GCAACCGTCT TCTGAAGTTC TGAGATATAT TTTTTTTTAC TTTAGTTACT AGATTTTTGT TTATTGTTTA CTTTTTTAGA
AACAATTGTT TGCTGGTACA TGCACTCTTT CATTAATCCT GCTTAAGATA ATACATTCCT TTTCCACTAA CCCAACCTTG
TGTTCTATGT TGCCTGAACG AAATTCTTCC ATAACCTTGA TGTATTTAAT TTACCAACAA AATTTTAGCT ATGATCTGAC
ATTTGATCTC TCTCTCGAAA ATTTCAGGAG CTAAGGAAAG CAGAAATGAA GCGGACGTGG AGCTAAATTG TTGAATTGAG
GCCGTGGTAC CAATTTTGTA CTCTTTAGTT TTTAGTCTAG TCTCTATAAC ATATTTGTGT TGGAGAAACA AACCGAGGAG
CTCGATGTAT GGGACATGTA TGATAGCCAT AAGTTATGCA TCACCATAGT CTGGCTTGAG GGCCTAAACT GCTTAATGTT
TATGCAAGCG CATGGTTCTA TTGTATCACC AGTTTTCTAT ACC