Os12t0617900-01

Locus

Os12g0617900

Description

Similar to Serine/threonine protein phosphatase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPPKL3, OsPP132

Oryzabase Gene Name Synonym(s)

protein phosphatase with Kelch-like repeat domain 3, Protein phosphatase 132

Transcript Evidence

AK066418 (DDBJ, Best hit)

Protein Evidence

B8BN16 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: phosphoprotein phosphatase activity (GO:0004721)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: protein binding (GO:0005515)

Molecular Function: hydrolase activity (GO:0016787)

Molecular Function: manganese ion binding (GO:0030145)

Functional domain (InterPro)

Metallophosphoesterase domain (IPR004843)

Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatase (IPR006186)

Kelch repeat type 2 (IPR011498)

Serine/threonine protein phosphatase, BSU1 (IPR012391)

Kelch-type beta propeller (IPR015915)

Full-length cDNA

J013067H19 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0617900-01)

Others

Oryzabase (11679)

Transcript

3346 bp

>Os12t0617900-01 Similar to Serine/threonine protein phosphatase.
TTTCCACTCTCGCCACCACCACTCCGCGACAAGCTCGTGCTCCCCCCCAAATCCCAAATC
TCCCAGGGGCCTCCTCGATCGATCCCATCCCCCCCCTCACTTCGCCGGCGGCGGCTGCGG
CGGCGTAAGCGGCGACGACCGGTGGTGTGGCGTGTTCTACCTAGGGTTTCGGTGGGGGGA
GGAGGGATGGCAGCGGCCTCGCCGCAAGTGGCAAGGAGTTGGGAGGAGTAGGCGGAGCTA
AGAGATTTTTTTGCTCTCTCGCTTCTTCTCTGTGTGTGTGTTGCGTGGTGGGGAGGAAGA
TCTCGAGCGGTTGGAAACCCTAGTGGGGAGGGAGGGAGTGGGCGGGGGGGATGGACGTGG
ACTCGAGGATGACGACGGAGTCGGACTCCGACTCGGACGCCGCGGCGCAGGGGGGAGGAG
GAGGAGGGTTCGGGAGCGAGACCTCCTCGGCGTCGCCCTCGGCGCCCGGGACGCCGACGG
CTATGGGGGCAGGAGGGGGAGCTGCTCCTATCGCTGCTGCTGCTATCGCTGCCGCCGCGT
CGGCGGCGGTGGTGGCGGGCCCGAGGCCCGCGCCGGGGTACACGGTGGTGAACGCGGCGA
TGGAGAAGAAGGAGGACGGGCCCGGGTGCCGGTGCGGCCACACGCTCACCGCGGTGCCGG
CCGTCGGGGAGGAGGGCGCGCCGGGGTACGTGGGGCCGCGGCTGATCCTCTTCGGCGGTG
CCACCGCGCTCGAGGGGAACTCCGCCACGCCGCCATCCTCGGCCGGGAGCGCCGGAATCC
GTCTTGCTGGTGCTACTGCGGATGTGCACTGCTACGATGTTTCATCGAATAAGTGGAGCA
GGCTTACTCCAGTTGGTGAACCTCCTTCACCAAGAGCGGCACATGTAGCGACTGCTGTTG
GCACCATGGTGGTCATTCAGGGTGGGATAGGTCCTGCTGGTTTATCTGCAGAAGACCTTC
ATGTTCTGGATCTTACACAACAACGACCGCGATGGCACAGAGTGGTGGTTCAAGGGCCTG
GCCCTGGTCCTCGATATGGACATGTGATGGCTTTGGTTGGGCAGCGTTTCTTGTTGACAA
TCGGTGGAAATGATGGGAAGAGGCCCCTGGCTGATGTGTGGGCCCTTGATACAGCAGCTA
AGCCATATGAGTGGAGGAAACTTGAACCAGAAGGTGAAGGACCACCCCCATGCATGTATG
CAACTGCAAGTGCCCGTTCTGATGGACTTCTATTACTCTGTGGTGGGAGGGATGCTAATA
GTGTGCCCCTAGCAAGTGCATATGGCCTTGCAAAACACAGGGATGGACGCTGGGAGTGGG
CAATCGCCCCTGGTGTCTCTCCATCACCCAGATATCAACATGCAGCTGTTTTCGTCAATG
CACGACTTCATGTCTCAGGAGGGGCCCTTGGAGGCGGTCGCATGGTTGAAGACTCCTCAA
GTGTTGCAGTGTTGGATACTGCTGCTGGAGTGTGGTGTGATACAAAATCAGTAGTTACTA
CTCCAAGGACAGGAAGATATAGTGCAGATGCTGCAGGCGGTGATGCTTCTGTAGAGCTTA
CACGACGGTGCAGGCATGCAGCTGCTGCAGTTGGTGATATGATATATGTTTATGGAGGTC
TACGGGGAGGTGTGCTGCTAGATGACCTTCTTGTTGCCGAAGATCTTGCTGCTGCTGAAA
CAACAAATGCAGCAAATCAGGCAGCTGCAATTGCTGCAGCCTCTGACATACAAGCTGGAA
GAGAACCTGGTAGGTATGCCTACAATGATGAACAAACAGGGCAGCCAGCTACAATAACAT
CTCCTGATGGAGCTGTGGTTCTTGGAACTCCAGTTGCTGCTCCCGTTAATGGGGACATGT
ATACTGATATTAGCCCTGAGAACGCTGTGATCCAGGGACAAAGGAGAATGAGCAAAGGTG
TTGATTATTTGGTTGAAGCATCTGCTGCAGAGGCTGAGGCAATCAGTGCTACTTTAGCTG
CTGTAAAAGCTCGGCAAGTTAATGGTGAGGCAGAGCATTCACCTGACAGGGAGCAGTCTC
CAGATGCCACACCAAGTGTGAAGCAAAATGCAAGCCTGATAAAACCAGACTATGCTCTTT
CAAATAATTCAACACCACCTCCTGGGGTTCGGTTACACCATAGAGCAGTTGTGGTAGCAG
CAGAAACCGGAGGTGCCTTAGGTGGCATGGTTAGGCAGCTCTCAATTGACCAGTTTGAAA
ATGAAGGAAGAAGGGTCATCTATGGCACTCCTGAGAGTGCAACTGCAGCAAGGAAGTTGC
TAGATCGGCAAATGTCTATTAATAGTGTACCTAAAAAGGTAATTGCATCCCTCTTGAAAC
CTCGTGGTTGGAAGCCCCCTGTGCGAAGGCAGTTCTTTTTGGACTGCAATGAGATTGCAG
ACCTATGTGATAGTGCGGAAAGAATATTTTCAAGTGAACCAAGTGTCCTACAGCTTAAAG
CTCCAATTAAGATATTTGGTGATTTGCACGGTCAATTTGGTGACCTAATGCGCTTGTTTG
ATGAGTACGGTGCTCCTTCGACAGCTGGAGACATTGCTTACATTGATTACCTCTTCTTGG
GAGATTACGTGGATCGTGGTCAGCATAGTTTGGAGACAATCACTCTTCTCCTTGCACTTA
AGGTTGAATATCCTCTTAATGTACATTTGATTCGAGGGAATCATGAGGCCGCTGATATCA
ATGCTTTGTTTGGGTTCCGAATAGAGTGCATAGAGCGAATGGGTGAGCGTGATGGGATCT
GGACCTGGCATCGCATGAATAGGCTATTTAATTGGCTTCCTTTGGCTGCCCTAATAGAGA
AGAAAATAATATGTATGCATGGTGGTATTGGCCGGTCTATCAATCATGTTGAACAAATTG
AGAATCTTCAAAGACCAATTACCATGGAAGCAGGCTCGGTTGTTCTAATGGATCTTCTGT
GGTCTGATCCAACTGAAAATGATAGTGTTGAAGGACTTAGACCAAATGCCCGTGGCCCAG
GCCTTGTTACCTTTGGGCCGGATCGTGTTATGGAGTTCTGCAACAACAATGACTTACAGT
TAATTGTGCGAGCACATGAGTGTGTGATGGATGGTTTTGAGCGTTTTGCTCAAGGTCACC
TAATCACTCTCTTCTCAGCAACAAATTACTGTGGTACGGCAAACAATGCGGGTGCAATCT
TGGTTCTAGGAAGAGATCTTGTAGTAGTTCCGAAACTCATCCATCCTTTGCCGCCTGCCA
TTACATCTCCCGAGACCTCTCCAGAGCATCATCTTGAGGACACATGGATGCAGGAACTAA
ATGCCAACAGGCCGCCAACTCCAACAAGGGGCCGCCCTCAAGCAGC

CDS

2996 bp

>Os12t0617900-01 Similar to Serine/threonine protein phosphatase.
ATGGACGTGGACTCGAGGATGACGACGGAGTCGGACTCCGACTCGGACGCCGCGGCGCAG
GGGGGAGGAGGAGGAGGGTTCGGGAGCGAGACCTCCTCGGCGTCGCCCTCGGCGCCCGGG
ACGCCGACGGCTATGGGGGCAGGAGGGGGAGCTGCTCCTATCGCTGCTGCTGCTATCGCT
GCCGCCGCGTCGGCGGCGGTGGTGGCGGGCCCGAGGCCCGCGCCGGGGTACACGGTGGTG
AACGCGGCGATGGAGAAGAAGGAGGACGGGCCCGGGTGCCGGTGCGGCCACACGCTCACC
GCGGTGCCGGCCGTCGGGGAGGAGGGCGCGCCGGGGTACGTGGGGCCGCGGCTGATCCTC
TTCGGCGGTGCCACCGCGCTCGAGGGGAACTCCGCCACGCCGCCATCCTCGGCCGGGAGC
GCCGGAATCCGTCTTGCTGGTGCTACTGCGGATGTGCACTGCTACGATGTTTCATCGAAT
AAGTGGAGCAGGCTTACTCCAGTTGGTGAACCTCCTTCACCAAGAGCGGCACATGTAGCG
ACTGCTGTTGGCACCATGGTGGTCATTCAGGGTGGGATAGGTCCTGCTGGTTTATCTGCA
GAAGACCTTCATGTTCTGGATCTTACACAACAACGACCGCGATGGCACAGAGTGGTGGTT
CAAGGGCCTGGCCCTGGTCCTCGATATGGACATGTGATGGCTTTGGTTGGGCAGCGTTTC
TTGTTGACAATCGGTGGAAATGATGGGAAGAGGCCCCTGGCTGATGTGTGGGCCCTTGAT
ACAGCAGCTAAGCCATATGAGTGGAGGAAACTTGAACCAGAAGGTGAAGGACCACCCCCA
TGCATGTATGCAACTGCAAGTGCCCGTTCTGATGGACTTCTATTACTCTGTGGTGGGAGG
GATGCTAATAGTGTGCCCCTAGCAAGTGCATATGGCCTTGCAAAACACAGGGATGGACGC
TGGGAGTGGGCAATCGCCCCTGGTGTCTCTCCATCACCCAGATATCAACATGCAGCTGTT
TTCGTCAATGCACGACTTCATGTCTCAGGAGGGGCCCTTGGAGGCGGTCGCATGGTTGAA
GACTCCTCAAGTGTTGCAGTGTTGGATACTGCTGCTGGAGTGTGGTGTGATACAAAATCA
GTAGTTACTACTCCAAGGACAGGAAGATATAGTGCAGATGCTGCAGGCGGTGATGCTTCT
GTAGAGCTTACACGACGGTGCAGGCATGCAGCTGCTGCAGTTGGTGATATGATATATGTT
TATGGAGGTCTACGGGGAGGTGTGCTGCTAGATGACCTTCTTGTTGCCGAAGATCTTGCT
GCTGCTGAAACAACAAATGCAGCAAATCAGGCAGCTGCAATTGCTGCAGCCTCTGACATA
CAAGCTGGAAGAGAACCTGGTAGGTATGCCTACAATGATGAACAAACAGGGCAGCCAGCT
ACAATAACATCTCCTGATGGAGCTGTGGTTCTTGGAACTCCAGTTGCTGCTCCCGTTAAT
GGGGACATGTATACTGATATTAGCCCTGAGAACGCTGTGATCCAGGGACAAAGGAGAATG
AGCAAAGGTGTTGATTATTTGGTTGAAGCATCTGCTGCAGAGGCTGAGGCAATCAGTGCT
ACTTTAGCTGCTGTAAAAGCTCGGCAAGTTAATGGTGAGGCAGAGCATTCACCTGACAGG
GAGCAGTCTCCAGATGCCACACCAAGTGTGAAGCAAAATGCAAGCCTGATAAAACCAGAC
TATGCTCTTTCAAATAATTCAACACCACCTCCTGGGGTTCGGTTACACCATAGAGCAGTT
GTGGTAGCAGCAGAAACCGGAGGTGCCTTAGGTGGCATGGTTAGGCAGCTCTCAATTGAC
CAGTTTGAAAATGAAGGAAGAAGGGTCATCTATGGCACTCCTGAGAGTGCAACTGCAGCA
AGGAAGTTGCTAGATCGGCAAATGTCTATTAATAGTGTACCTAAAAAGGTAATTGCATCC
CTCTTGAAACCTCGTGGTTGGAAGCCCCCTGTGCGAAGGCAGTTCTTTTTGGACTGCAAT
GAGATTGCAGACCTATGTGATAGTGCGGAAAGAATATTTTCAAGTGAACCAAGTGTCCTA
CAGCTTAAAGCTCCAATTAAGATATTTGGTGATTTGCACGGTCAATTTGGTGACCTAATG
CGCTTGTTTGATGAGTACGGTGCTCCTTCGACAGCTGGAGACATTGCTTACATTGATTAC
CTCTTCTTGGGAGATTACGTGGATCGTGGTCAGCATAGTTTGGAGACAATCACTCTTCTC
CTTGCACTTAAGGTTGAATATCCTCTTAATGTACATTTGATTCGAGGGAATCATGAGGCC
GCTGATATCAATGCTTTGTTTGGGTTCCGAATAGAGTGCATAGAGCGAATGGGTGAGCGT
GATGGGATCTGGACCTGGCATCGCATGAATAGGCTATTTAATTGGCTTCCTTTGGCTGCC
CTAATAGAGAAGAAAATAATATGTATGCATGGTGGTATTGGCCGGTCTATCAATCATGTT
GAACAAATTGAGAATCTTCAAAGACCAATTACCATGGAAGCAGGCTCGGTTGTTCTAATG
GATCTTCTGTGGTCTGATCCAACTGAAAATGATAGTGTTGAAGGACTTAGACCAAATGCC
CGTGGCCCAGGCCTTGTTACCTTTGGGCCGGATCGTGTTATGGAGTTCTGCAACAACAAT
GACTTACAGTTAATTGTGCGAGCACATGAGTGTGTGATGGATGGTTTTGAGCGTTTTGCT
CAAGGTCACCTAATCACTCTCTTCTCAGCAACAAATTACTGTGGTACGGCAAACAATGCG
GGTGCAATCTTGGTTCTAGGAAGAGATCTTGTAGTAGTTCCGAAACTCATCCATCCTTTG
CCGCCTGCCATTACATCTCCCGAGACCTCTCCAGAGCATCATCTTGAGGACACATGGATG
CAGGAACTAAATGCCAACAGGCCGCCAACTCCAACAAGGGGCCGCCCTCAAGCAGC

Protein

998 aa

>Os12t0617900-01 Similar to Serine/threonine protein phosphatase.
MDVDSRMTTESDSDSDAAAQGGGGGGFGSETSSASPSAPGTPTAMGAGGGAAPIAAAAIA
AAASAAVVAGPRPAPGYTVVNAAMEKKEDGPGCRCGHTLTAVPAVGEEGAPGYVGPRLIL
FGGATALEGNSATPPSSAGSAGIRLAGATADVHCYDVSSNKWSRLTPVGEPPSPRAAHVA
TAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRF
LLTIGGNDGKRPLADVWALDTAAKPYEWRKLEPEGEGPPPCMYATASARSDGLLLLCGGR
DANSVPLASAYGLAKHRDGRWEWAIAPGVSPSPRYQHAAVFVNARLHVSGGALGGGRMVE
DSSSVAVLDTAAGVWCDTKSVVTTPRTGRYSADAAGGDASVELTRRCRHAAAAVGDMIYV
YGGLRGGVLLDDLLVAEDLAAAETTNAANQAAAIAAASDIQAGREPGRYAYNDEQTGQPA
TITSPDGAVVLGTPVAAPVNGDMYTDISPENAVIQGQRRMSKGVDYLVEASAAEAEAISA
TLAAVKARQVNGEAEHSPDREQSPDATPSVKQNASLIKPDYALSNNSTPPPGVRLHHRAV
VVAAETGGALGGMVRQLSIDQFENEGRRVIYGTPESATAARKLLDRQMSINSVPKKVIAS
LLKPRGWKPPVRRQFFLDCNEIADLCDSAERIFSSEPSVLQLKAPIKIFGDLHGQFGDLM
RLFDEYGAPSTAGDIAYIDYLFLGDYVDRGQHSLETITLLLALKVEYPLNVHLIRGNHEA
ADINALFGFRIECIERMGERDGIWTWHRMNRLFNWLPLAALIEKKIICMHGGIGRSINHV
EQIENLQRPITMEAGSVVLMDLLWSDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNN
DLQLIVRAHECVMDGFERFAQGHLITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPL
PPAITSPETSPEHHLEDTWMQELNANRPPTPTRGRPQA

5'UTR

chr12:26315454..26315803 (- strand) : 350 bp

CDS

chr12:26315024..26315453 (- strand) : 430 bp

chr12:26314035..26314095 (- strand) : 61 bp

chr12:26313786..26313864 (- strand) : 79 bp

chr12:26313625..26313704 (- strand) : 80 bp

chr12:26313447..26313541 (- strand) : 95 bp

chr12:26313246..26313345 (- strand) : 100 bp

chr12:26312653..26312722 (- strand) : 70 bp

chr12:26311972..26312073 (- strand) : 102 bp

chr12:26311786..26311867 (- strand) : 82 bp

chr12:26311199..26311378 (- strand) : 180 bp

chr12:26310424..26310697 (- strand) : 274 bp

chr12:26310049..26310292 (- strand) : 244 bp

chr12:26309677..26309847 (- strand) : 171 bp

chr12:26309230..26309468 (- strand) : 239 bp

chr12:26308839..26308923 (- strand) : 85 bp

chr12:26308643..26308741 (- strand) : 99 bp

chr12:26308363..26308562 (- strand) : 200 bp

chr12:26308199..26308274 (- strand) : 76 bp

chr12:26307972..26308107 (- strand) : 136 bp

chr12:26307746..26307885 (- strand) : 140 bp

chr12:26307596..26307648 (- strand) : 53 bp

FASTA

>Os12t0617900-01 class=Sequence position=chr12:26307596..26315803 (- strand)
TTTCCACTCT CGCCACCACC ACTCCGCGAC AAGCTCGTGC TCCCCCCCAA ATCCCAAATC TCCCAGGGGC CTCCTCGATC
GATCCCATCC CCCCCCTCAC TTCGCCGGCG GCGGCTGCGG CGGCGTAAGC GGCGACGACC GGTGGTGTGG CGTGTTCTAC
CTAGGGTTTC GGTGGGGGGA GGAGGGATGG CAGCGGCCTC GCCGCAAGTG GCAAGGAGTT GGGAGGAGTA GGCGGAGCTA
AGAGATTTTT TTGCTCTCTC GCTTCTTCTC TGTGTGTGTG TTGCGTGGTG GGGAGGAAGA TCTCGAGCGG TTGGAAACCC
TAGTGGGGAG GGAGGGAGTG GGCGGGGGGG ATGGACGTGG ACTCGAGGAT GACGACGGAG TCGGACTCCG ACTCGGACGC
CGCGGCGCAG GGGGGAGGAG GAGGAGGGTT CGGGAGCGAG ACCTCCTCGG CGTCGCCCTC GGCGCCCGGG ACGCCGACGG
CTATGGGGGC AGGAGGGGGA GCTGCTCCTA TCGCTGCTGC TGCTATCGCT GCCGCCGCGT CGGCGGCGGT GGTGGCGGGC
CCGAGGCCCG CGCCGGGGTA CACGGTGGTG AACGCGGCGA TGGAGAAGAA GGAGGACGGG CCCGGGTGCC GGTGCGGCCA
CACGCTCACC GCGGTGCCGG CCGTCGGGGA GGAGGGCGCG CCGGGGTACG TGGGGCCGCG GCTGATCCTC TTCGGCGGTG
CCACCGCGCT CGAGGGGAAC TCCGCCACGC CGCCATCCTC GGCCGGGAGC GCCGGAATCC GTAATGCCCT TTTAAACCTC
AGCTGCTCTT GTTTTCATGT ATGGTTTGGG GGGATGGTGT TGGCGTGCTA ATTGTTTAGT TTGCTGTCGA CGAGAGCCAA
ACTCCATGGG AGTTGGAATA CTTGGGTTTG TACTGAATCT TGCTCGGGAC TTTGGAGTGA TATGCTGGTT CGCGTACCGA
CTGATTTAGG GATATAACTT ACTGTTCGGG ATAGCAGCTA GAGTTGATTG TAGCTCTGGT GTTTCAGTGT CTTAGTTAGA
GGTAGAATTC GGAGCATCTG CTGATGGTGG TATTGCTAGT GTAGGCTGGA TTAGGTTAAA AACTCGTACT GGGAGGGATT
TTCATGTTCT GCCTGGTTAG GAAAGCGATT ATGAGTGGCA CGTTATGACA ATATATGCAG TGTAACTCAT GTGCACATGC
TGTTAATTGG AGGGCCAAAT ATGGTGCTCT TTTATGATTT GAGGCACAAG ATTTATTTAA TGAACAACGA TACTCGCATA
CTTCTGTTGC GGTGAAGTAC CAGTTCCTTT TAATGTTTGT TGGTTGTTTC CTTTGGATTA TGATTGTCTT TGTATGTTAG
AAGAAGCACT CAAAGGTTTC AAATTGGAAA AACATTTATG TGCTTAGACT GTACTGATGC CCTTGGATAC CCTAGGGCCT
AGGTTAAGGC GTATGGGTTA ATTAATTAGG TGAACTATGC CGTTTCAAAA GTTAAGCCTG AAATGCTATT ATACGCATTC
CGGTTCTCCA AGTCTTATTG GGGGATTAGA CGTTTTGGTA GACCGGGTGC CAAATGTATT GTTTCAAAAC TGAGCTTAGA
AATGTTGGAG GTTTTGCTTG TGATGAAAGG GAAAGTTTAT CTTCTTTATA GGCAAATCAG CAAAATTGAC AAGATCTTAC
ATAAAATTAT CAATCTCCTT TCTTGCAGGT CTTGCTGGTG CTACTGCGGA TGTGCACTGC TACGATGTTT CATCGAATAA
GTGGAGCAGG TATGTTCTTT TTAGTAAGAG CCTTTTTTAG TAAATGTTTT AATTCCTTTG GATATTATGC TTGGATGCCA
TGTGTAAGTT TTTCTTTAGA TCCCATGAAA TTTTATCTCA ATTGCACTTG TTAGTTCTGT GCACTACTAC ATTTGATTGA
CCACAGTAAA TGTTGTCAGG CTTACTCCAG TTGGTGAACC TCCTTCACCA AGAGCGGCAC ATGTAGCGAC TGCTGTTGGC
ACCATGGTGG TCATTCAGGT AGCTTTAATC TTTTTGCCTT AGAGTAGTAG CTATGTCAGT TTTATCGTCA GGCCAGCACT
AACCTGCTCT CAACTACAGG GTGGGATAGG TCCTGCTGGT TTATCTGCAG AAGACCTTCA TGTTCTGGAT CTTACACAAC
AACGACCGCG ATGGCACAGG TGGCTGCTGC TCTAATTTCG TTTGGGTTTA GAATATGCTT TTGCTGCTAT CCCTAGTGAG
CATTATCATG TCTTGTATGT AGAGTGGTGG TTCAAGGGCC TGGCCCTGGT CCTCGATATG GACATGTGAT GGCTTTGGTT
GGGCAGCGTT TCTTGTTGAC AATCGGTGGA AATGATGGTA GGAGATTGCT TATGTGCCTA TGAAACCTAG ATTTTGGCTA
CTTAAGATAT TGTTCCATCC CAAATGATGT TGATACTAAG AGTGAATAAA TGTTTCAGGG AAGAGGCCCC TGGCTGATGT
GTGGGCCCTT GATACAGCAG CTAAGCCATA TGAGTGGAGG AAACTTGAAC CAGAAGGTGA AGGACCACCC CCATGCATGT
AAGTGTGCAG ATAATAAAAA AGGAAACATC TCCCCTTTGA AATCTAGATC AACGAGGTTC TTTGGTGATG TTGAGTTTAA
ATCTTGCTAT TTTCTTGGCA AGATTCCCCA GCTACATCCA TGAGCCAACA TATGATAATG CCTATATTTT CTAATGAAGC
TTTCAGTGAT TGTACTTTTG TTTGATGCCC ATATCATATA TAGTAACCTG TTTTGGCACC ATTAGACTAC TTTTAGGGCT
CCACTTTCTT TTGTTGGCCA AGAAGTTACA GAAAACTTTG GTTATTTACA ACTCAATATT GATAGTTTGT TCAAAAGCAA
CTGCCAATTA AGAACAAGCT ACAAGTGTTT CGTTAAGTCT ACTTGGATGC AGAACACAGT AAAGTGTCAA ACCTAATATC
CTAGGGTAAC CCACCACTAG CTATTTTCTG TAATTTCACT TACGCTTTTC AATAGATTGC TAGAAGTTGA GATAGTTTTT
GTATACTTCT AATAGTCTGT GCCTCTGGTA ATGTTGCTCA GGTATGCAAC TGCAAGTGCC CGTTCTGATG GACTTCTATT
ACTCTGTGGT GGGAGGGATG CTAATAGTGT GGTAAGTACC ATTCTATTTG TGAATAGCTT TTGCTGAGGA AATTTTGTTC
TAATAGGAAT ATAGGGTTGA AATTCTCTGT TCTTAGTTTT TAGATTTGAA TCTGCTCTGA AGTCATAACA CGAGAATGGT
TCATATAGCT TTTTTGGTAA GTGATATTTA TAAGCATTGC ATGCTTGTGC CAACAAAGCA TATTTATTTT TTCTCATGTT
ACATCTGCTT CTTTGGATGA GTGAGGAATT GTGATGTTAA GTGCACTGAA TCCATATGGC ATGCTTGAAA GGCCTGTTTT
GTTCAATTTC ACTTGTAAAG CCATGCCCTG CAAATAAAAA AAATAGAATC GTCTGGGCTG GAAACTGAAT ATGGATTCAA
CCGATTAGTT TTCATTAGAT GGTAAGTGAT TAGCATTTTG TAGGTGAATT GAAATAAGGA TATATATGGA CTTTTCTTTT
TGGTAATTAC GATTTTGGAG AGGCAGTGAC TTCTATTTGT ATGTCCTACA CTGTTTTACT CCAAGGCTCA AGCATATTTG
TCAAAGCTAA CTATGTAGTT TTTCCTTTTC TTTTGGGCTA AAACCATCAG CCCCTAGCAA GTGCATATGG CCTTGCAAAA
CACAGGGATG GACGCTGGGA GTGGGCAATC GCCCCTGGTG TCTCTCCATC ACCCAGATAT CAACATGCAG CTGTGAGTTG
TGAATATCCT TTCCCTTCAA TTTTCTTTAT TTTTCATCTT GAGATGGATC CCACTGCATG GTTTGTGTCA TGTTTTATTT
CCTTTTGTTT CTTTAGGTTT TCGTCAATGC ACGACTTCAT GTCTCAGGAG GGGCCCTTGG AGGCGGTCGC ATGGTTGAAG
ACTCCTCAAG TGTTGCAGGT TCCTTACTAT TATTTGCTTT GTATACTTTG CACCTGTTAG TTCATGTGGC ATCCTTTTGA
AAAATCTCCC ACCTTTTGTG GCAACTCGAA ACATTTCAAG CAATTTCTTT TGATTGTAAG TAGGATAAAG ACCATATATG
ATTAATTATT TCAATTACTA AGTTCAATAT ATTGTTTTCT GTTTGCTAAA TTACCCATTT ACAATTCATC AGCAGAGAAC
AAGATGCATG CTGTTATTGA TTGTCTCTGC AGTTCATATA TCTTGTATTA TTGAAAAAAG TAAATGGTCT GAATAATACT
GGAACACAGT CGGTAGTTTA AGCATTGGCC AGTTGGTCTT AGTATGCATG TATATTTTCT TGTTTCCCTA GGTTCTTATT
TTTAAGCCAT GCTGCCCTTT TTCAGTGTTG GATACTGCTG CTGGAGTGTG GTGTGATACA AAATCAGTAG TTACTACTCC
AAGGACAGGA AGATATAGTG CAGATGCTGC AGGCGGTGAT GCTTCTGTAG AGCTTACACG ACGGTGCAGG CATGCAGCTG
CTGCAGTTGG TGATATGATA TATGTTTATG GAGGTCTACG GGGAGGTAAG ACACTTCAGT TTCTTAGCCT CATCTGATTT
CTGACACCAA TTCTCATGTT TGAATTGCGA TCCGCTGTCC TATGAGTCCT GTTCAGCTGT ATTCAGCAGC ACACGTTTTT
TAAGTAGTAA AGATGTTATC CGATGAGGAA CATGTATATT CTTTCTGGGA AGATAAGGAA TTTAGGATAT TAAGATATCA
GTACAAATTT AATTAGCATT GACTATGTTT ACATAGCAGA TCCAAAAGGT TTTTAAGGTG ATCCGGATTT CAGCTTAATG
GATTTCCAAT TAACATTAGT ATTATTACAA TATCCTTATC TGAATGAAAA ACTACTCCTG GAGCTAACTG TTAACTAACT
TTTTACACTT GCATCACTTT TTTGAGGGTT GACTTTGGGT TATCAGAGCG AAATTGCCTC CTATTCAAAT TAGGATATAT
TCATATTTTT GTTGATGCTA AGTTTTGTAT AGTTGCAATT CTAAATTCCC TTTATTGTTA CTCCAGGTGT GCTGCTAGAT
GACCTTCTTG TTGCCGAAGA TCTTGCTGCT GCTGAAACAA CAAATGCAGC AAATCAGGCA GCTGCAATTG CTGCAGCCTC
TGACATACAA GCTGGAAGAG AACCTGGTAG GTATGCCTAC AATGATGAAC AAACAGGGCA GCCAGCTACA ATAACATCTC
CTGATGGAGC TGTGGTTCTT GGAACTCCAG TTGCTGCTCC CGTTAATGGG GACATGTATA CTGATATTAG CCCTGAGAAC
GCTGTGATCC AGGGACAAAG GTTTGTAAAA TTTCGTAGAC ATGTTCCGAT AGTTTTTATT TTATTTTATT TTATTTTTTT
TGCATATCTA TCAGTCTATT GAGTAGAAGC TACATGCACT GAAATGTGTC TTTTGGTCTT GATTTGCACA GGAGAATGAG
CAAAGGTGTT GATTATTTGG TTGAAGCATC TGCTGCAGAG GCTGAGGCAA TCAGTGCTAC TTTAGCTGCT GTAAAAGCTC
GGCAAGTTAA TGGTGAGGCA GAGCATTCAC CTGACAGGGA GCAGTCTCCA GATGCCACAC CAAGTGTGAA GCAAAATGCA
AGCCTGATAA AACCAGACTA TGCTCTTTCA AATAATTCAA CACCACCTCC TGGGGTTCGG TTACACCATA GAGCAGTAAG
TAGAAAATGC AGTTAGTTTT ACCGAGTTAA TTCGTTACTT TATTTGCTTC TCTAGTTAAT TGATAAATTC AAAACCAGAT
CATGATCTTT CCTTGTTCTA CTGTTGAAAT ATATTGTATT ACAGAAGCTG TCCCTGAACA ACCTAGCTCA AGTTAGTTAC
AGCATTGTGA ACTTTATTTT TTTCTTGCTC TTGTAGGTTG TGGTAGCAGC AGAAACCGGA GGTGCCTTAG GTGGCATGGT
TAGGCAGCTC TCAATTGACC AGTTTGAAAA TGAAGGAAGA AGGGTCATCT ATGGCACTCC TGAGAGTGCA ACTGCAGCAA
GGAAGTTGCT AGATCGGCAA ATGTCTATTA ATAGTGTACC TAAAAAGGTA TCTTACTTTG CAGATGTAAT TTGACAAAAA
AAAACAGCAA ACAATTGCAT GATTATCTGC TAAAACACTA AGGCAATGGC ATACACTGGT GTGTGTTGTT GTCAGGGGGC
ATAAATGGAA GTCATGATAA CCTTTGCCTT TAAACTTCTA TGCTATTGTG CTATTAAGTA CTCACATATT TCTATTTGAT
GACAAAATTA TTCAGGTAAT TGCATCCCTC TTGAAACCTC GTGGTTGGAA GCCCCCTGTG CGAAGGCAGT TCTTTTTGGA
CTGCAATGAG ATTGCAGACC TATGTGATAG TGCGGAAAGA ATATTTTCAA GTGAACCAAG TGTCCTACAG CTTAAAGCTC
CAATTAAGAT ATTTGGTGAT TTGCACGGTC AATTTGGTGA CCTAATGCGC TTGTTTGATG AGTACGGTGC TCCTTCGACA
GCTGGAGACA TTGCGTGAGT ATTTTCTGAT TTTGAACTGC CCTGATTCAT TTACTTATTC ATTCCAATTT TGGGAACTTT
TATGGCATTT TATTGGATGA CAAAGCTGAA AAACCTTTTT TTTTTCAAAA AAGAACCTCT AGAACACTTT ATGTTAAGTT
GTTTTATTTT CAGTTATATT ATTGATACTT TATCTGAACT TCTTGATTTG CGTATATAGG CTTTGGGTTA GAAAATGTTC
GGTTAGAGGA GATATTTTCA ATCGATCTTT CCTGACTTAT ATGTTTTCCT TTTGTTTTTT TTGTTCAAAA AACTTTGCAG
TTACATTGAT TACCTCTTCT TGGGAGATTA CGTGGATCGT GGTCAGCATA GTTTGGAGAC AATCACTCTT CTCCTTGCAC
TTAAGGTAAA GTTGTGAACA ACTGAGCGAA CCCTGAAAAA GTGCTATTTC AGCAGACAGT TCTTTTTCTC TCAAAAATGT
AACAATTGAT CTTATAATTC AGGTTGAATA TCCTCTTAAT GTACATTTGA TTCGAGGGAA TCATGAGGCC GCTGATATCA
ATGCTTTGTT TGGGTTCCGA ATAGAGTGCA TAGAGCGAAT GGTAATGACC ATGTTGCATT CTGACATTCT TATTAGGCTG
TTTTTTATCT CTTGCTTATC ACTGTTCTTT GCTAAAAACA GGGTGAGCGT GATGGGATCT GGACCTGGCA TCGCATGAAT
AGGCTATTTA ATTGGCTTCC TTTGGCTGCC CTAATAGAGA AGAAAATAAT ATGTATGCAT GGTGGTATTG GCCGGTCTAT
CAATCATGTT GAACAAATTG AGAATCTTCA AAGACCAATT ACCATGGAAG CAGGCTCGGT TGTTCTAATG GATCTTCTGT
GGTCAGCATT TCAATAGCTC TTTGATACTA CTATTGCAAG ATTGTTCTTT ATTTTTCCCT GATATAACCT ATTTTTTAAA
TCTTAAAAGG TCTGATCCAA CTGAAAATGA TAGTGTTGAA GGACTTAGAC CAAATGCCCG TGGCCCAGGC CTTGTTACCT
TTGGGGTTAG TATTCTCTGT GTAATGTTGT GTCCAGCTCT TTTCTCCCTG TTGGTTCGTG TGGTTTCTGT CAAAATAACA
CGTATTGTAA CTGCAGCCGG ATCGTGTTAT GGAGTTCTGC AACAACAATG ACTTACAGTT AATTGTGCGA GCACATGAGT
GTGTGATGGA TGGTTTTGAG CGTTTTGCTC AAGGTCACCT AATCACTCTC TTCTCAGCAA CAAATTACTG TGGTAATGAT
ATGCTATTCT GACTTGGTCT GTTCGCGATT ATCTCTTCAA GTTTGATTGT CCTGTTACTT AATATGATAT GTATGCAGGT
ACGGCAAACA ATGCGGGTGC AATCTTGGTT CTAGGAAGAG ATCTTGTAGT AGTTCCGAAA CTCATCCATC CTTTGCCGCC
TGCCATTACA TCTCCCGAGA CCTCTCCAGA GCATCATCTT GAGGACACAT GGATGCAGGT AACTCCTCTT TTATCATGTG
ATGCTCTTGG ATTTGCAATA GGGTATTCCT GTCTATACGC TTCTAAGTTC TAACACCATC TTGTGTTAAA ATCAGGAACT
AAATGCCAAC AGGCCGCCAA CTCCAACAAG GGGCCGCCCT CAAGCAGC

Locus: Os12g0617900

Loading...

Locus: Os12g0617900

Loading...