Os12t0617900-02

Locus

Os12g0617900

Description

Similar to Serine/threonine protein phosphatase BSL2 (EC 3.1.3.16) (BSU1-like protein 2).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPPKL3, OsPP132

Oryzabase Gene Name Synonym(s)

protein phosphatase with Kelch-like repeat domain 3, Protein phosphatase 132

Transcript Evidence

AK065064 (DDBJ, Best hit)

Protein Evidence

B8BN16 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: phosphoprotein phosphatase activity (GO:0004721)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: protein binding (GO:0005515)

Molecular Function: hydrolase activity (GO:0016787)

Molecular Function: manganese ion binding (GO:0030145)

Functional domain (InterPro)

Metallophosphoesterase domain (IPR004843)

Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatase (IPR006186)

Kelch repeat type 2 (IPR011498)

Serine/threonine protein phosphatase, BSU1 (IPR012391)

Kelch-type beta propeller (IPR015915)

Full-length cDNA

J013001J19 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0617900-02)

RiceXPro (AK065064)

Others

Oryzabase (11679)

KEGG (Os12t0617900-02 (EC:3.1.3.16))

Transcript

3802 bp

>Os12t0617900-02 Similar to Serine/threonine protein phosphatase BSL2 (EC 3.1.3.16) (BSU1-like protein 2).
GTGTGTGTGTTGCGTGGTGGGGAGGAAGATCTCGAGCGGTTGGAAACCCTAGTGGGGAGG
GAGGGAGTGGGCGGGGGGGATGGACGTGGACTCGAGGATGACGACGGAGTCGGACTCCGA
CTCGGACGCCGCGGCGCAGGGGGGAGGAGGAGGAGGGTTCGGGAGCGAGACCTCCTCGGC
GTCGCCCTCGGCGCCCGGGACGCCGACGGCTATGGGGGCAGGAGGGGGAGCTGCTCCTAT
CGCTGCTGCTGCTATCGCTGCCGCCGCGTCGGCGGCGGTGGTGGCGGGCCCGAGGCCCGC
GCCGGGGTACACGGTGGTGAACGCGGCGATGGAGAAGAAGGAGGACGGGCCCGGGTGCCG
GTGCGGCCACACGCTCACCGCGGTGCCGGCCGTCGGGGAGGAGGGCGCGCCGGGGTACGT
GGGGCCGCGGCTGATCCTCTTCGGCGGTGCCACCGCGCTCGAGGGGAACTCCGCCACGCC
GCCATCCTCGGCCGGGAGCGCCGGAATCCGTCTTGCTGGTGCTACTGCGGATGTGCACTG
CTACGATGTTTCATCGAATAAGTGGAGCAGGCTTACTCCAGTTGGTGAACCTCCTTCACC
AAGAGCGGCACATGTAGCGACTGCTGTTGGCACCATGGTGGTCATTCAGGGTGGGATAGG
TCCTGCTGGTTTATCTGCAGAAGACCTTCATGTTCTGGATCTTACACAACAACGACCGCG
ATGGCACAGAGTGGTGGTTCAAGGGCCTGGCCCTGGTCCTCGATATGGACATGTGATGGC
TTTGGTTGGGCAGCGTTTCTTGTTGACAATCGGTGGAAATGATGGGAAGAGGCCCCTGGC
TGATGTGTGGGCCCTTGATACAGCAGCTAAGCCATATGAGTGGAGGAAACTTGAACCAGA
AGGTGAAGGACCACCCCCATGCATGTATGCAACTGCAAGTGCCCGTTCTGATGGACTTCT
ATTACTCTGTGGTGGGAGGGATGCTAATAGTGTGCCCCTAGCAAGTGCATATGGCCTTGC
AAAACACAGGGATGGACGCTGGGAGTGGGCAATCGCCCCTGGTGTCTCTCCATCACCCAG
ATATCAACATGCAGCTGTTTTCGTCAATGCACGACTTCATGTCTCAGGAGGGGCCCTTGG
AGGCGGTCGCATGGTTGAAGACTCCTCAAGTGTTGCAGTGTTGGATACTGCTGCTGGAGT
GTGGTGTGATACAAAATCAGTAGTTACTACTCCAAGGACAGGAAGATATAGTGCAGATGC
TGCAGGCGGTGATGCTTCTGTAGAGCTTACACGACGGTGCAGGCATGCAGCTGCTGCAGT
TGGTGATATGATATATGTTTATGGAGGTCTACGGGGAGGTGTGCTGCTAGATGACCTTCT
TGTTGCCGAAGATCTTGCTGCTGCTGAAACAACAAATGCAGCAAATCAGGCAGCTGCAAT
TGCTGCAGCCTCTGACATACAAGCTGGAAGAGAACCTGGTAGGTATGCCTACAATGATGA
ACAAACAGGGCAGCCAGCTACAATAACATCTCCTGATGGAGCTGTGGTTCTTGGAACTCC
AGTTGCTGCTCCCGTTAATGGGGACATGTATACTGATATTAGCCCTGAGAACGCTGTGAT
CCAGGGACAAAGGAGAATGAGCAAAGGTGTTGATTATTTGGTTGAAGCATCTGCTGCAGA
GGCTGAGGCAATCAGTGCTACTTTAGCTGCTGTAAAAGCTCGGCAAGTTAATGGTGAGGC
AGAGCATTCACCTGACAGGGAGCAGTCTCCAGATGCCACACCAAGTGTGAAGCAAAATGC
AAGCCTGATAAAACCAGACTATGCTCTTTCAAATAATTCAACACCACCTCCTGGGGTTCG
GTTACACCATAGAGCAGTTGTGGTAGCAGCAGAAACCGGAGGTGCCTTAGGTGGCATGGT
TAGGCAGCTCTCAATTGACCAGTTTGAAAATGAAGGAAGAAGGGTCATCTATGGCACTCC
TGAGAGTGCAACTGCAGCAAGGAAGTTGCTAGATCGGCAAATGTCTATTAATAGTGTACC
TAAAAAGGTAATTGCATCCCTCTTGAAACCTCGTGGTTGGAAGCCCCCTGTGCGAAGGCA
GTTCTTTTTGGACTGCAATGAGATTGCAGACCTATGTGATAGTGCGGAAAGAATATTTTC
AAGTGAACCAAGTGTCCTACAGCTTAAAGCTCCAATTAAGATATTTGGTGATTTGCACGG
TCAATTTGGTGACCTAATGCGCTTGTTTGATGAGTACGGTGCTCCTTCGACAGCTGGAGA
CATTGCTTACATTGATTACCTCTTCTTGGGAGATTACGTGGATCGTGGTCAGCATAGTTT
GGAGACAATCACTCTTCTCCTTGCACTTAAGGTTGAATATCCTCTTAATGTACATTTGAT
TCGAGGGAATCATGAGGCCGCTGATATCAATGCTTTGTTTGGGTTCCGAATAGAGTGCAT
AGAGCGAATGGGTGAGCGTGATGGGATCTGGACCTGGCATCGCATGAATAGGCTATTTAA
TTGGCTTCCTTTGGCTGCCCTAATAGAGAAGAAAATAATATGTATGCATGGTGGTATTGG
CCGGTCTATCAATCATGTTGAACAAATTGAGAATCTTCAAAGACCAATTACCATGGAAGC
AGGCTCGGTTGTTCTAATGGATCTTCTGTGGTCTGATCCAACTGAAAATGATAGTGTTGA
AGGACTTAGACCAAATGCCCGTGGCCCAGGCCTTGTTACCTTTGGGCCGGATCGTGTTAT
GGAGTTCTGCAACAACAATGACTTACAGTTAATTGTGCGAGCACATGAGTGTGTGATGGA
TGGTTTTGAGCGTTTTGCTCAAGGTCACCTAATCACTCTCTTCTCAGCAACAAATTACTG
TGGTACGGCAAACAATGCGGGTGCAATCTTGGTTCTAGGAAGAGATCTTGTAGTAGTTCC
GAAACTCATCCATCCTTTGCCGCCTGCCATTACATCTCCCGAGACCTCTCCAGAGCATCA
TCTTGAGGACACATGGATGCAGGAACTAAATGCCAACAGGCCGCCAACTCCAACAAGGGG
CCGCCCTCAAGCAGCAAACAATGACCGAGGCTCTCTTGCATGGATATAGTAGCTTTGGCA
TGCGCTGAATTTATTCATTCCAAGTCCTCATCATTGGGTTCTGGCTAAGCTACATTTATC
CGTTCTGCACAGAGGCAGACGATCTGTGCTCAAGAGACGTGCTAGCCCACAACAATTGCC
AACTTGGAGGTCGTTTGCAGAGGAGAGCTAAGCTACAGAAAGAACCAAGGGTGGAGAAAC
TTCGCCAATCACCACCGACAGCGCTCTCCAATTTCTTTTCCCAAATCATGAGAAGTAAAT
GAACATATTCTTGGTCGTTCATCGGAAGATCCTACCTGCGAGGCTTCGCCCCTGTATATA
CTCAGATGATGCCCCAGCGGATAGGTGAGTGGGGTGTATGTGTTTTGGTCAACCGATTTG
AGGAACAGAAGGGATAGTGTAACTAGTGGTTATTGTACTAGGTATTCTTTTCCTGTGTCT
AGATTTTGTTTTTACCATGTTGGAAAAGTATTGGAGTGGCCAAAGGAGTAAACTTATTGG
ATGGGGTCCATCTAGTTGTTGTATAATAGCTGTCTCACCTATTTGTGTTATCACGCCTTC
CTCCCATTTGTAATACTACCTGTCTCTGGTGCTGACATGATGTACAATATTATCCTTGTC
GTCAAAATTTTGTGTAGTGAACAAAGTTGGTGATTGTTTGATTTGTTAGGGGTGGTAAGA
GCAGCCTTGTATTGTACTGTCC

CDS

3030 bp

>Os12t0617900-02 Similar to Serine/threonine protein phosphatase BSL2 (EC 3.1.3.16) (BSU1-like protein 2).
ATGGACGTGGACTCGAGGATGACGACGGAGTCGGACTCCGACTCGGACGCCGCGGCGCAG
GGGGGAGGAGGAGGAGGGTTCGGGAGCGAGACCTCCTCGGCGTCGCCCTCGGCGCCCGGG
ACGCCGACGGCTATGGGGGCAGGAGGGGGAGCTGCTCCTATCGCTGCTGCTGCTATCGCT
GCCGCCGCGTCGGCGGCGGTGGTGGCGGGCCCGAGGCCCGCGCCGGGGTACACGGTGGTG
AACGCGGCGATGGAGAAGAAGGAGGACGGGCCCGGGTGCCGGTGCGGCCACACGCTCACC
GCGGTGCCGGCCGTCGGGGAGGAGGGCGCGCCGGGGTACGTGGGGCCGCGGCTGATCCTC
TTCGGCGGTGCCACCGCGCTCGAGGGGAACTCCGCCACGCCGCCATCCTCGGCCGGGAGC
GCCGGAATCCGTCTTGCTGGTGCTACTGCGGATGTGCACTGCTACGATGTTTCATCGAAT
AAGTGGAGCAGGCTTACTCCAGTTGGTGAACCTCCTTCACCAAGAGCGGCACATGTAGCG
ACTGCTGTTGGCACCATGGTGGTCATTCAGGGTGGGATAGGTCCTGCTGGTTTATCTGCA
GAAGACCTTCATGTTCTGGATCTTACACAACAACGACCGCGATGGCACAGAGTGGTGGTT
CAAGGGCCTGGCCCTGGTCCTCGATATGGACATGTGATGGCTTTGGTTGGGCAGCGTTTC
TTGTTGACAATCGGTGGAAATGATGGGAAGAGGCCCCTGGCTGATGTGTGGGCCCTTGAT
ACAGCAGCTAAGCCATATGAGTGGAGGAAACTTGAACCAGAAGGTGAAGGACCACCCCCA
TGCATGTATGCAACTGCAAGTGCCCGTTCTGATGGACTTCTATTACTCTGTGGTGGGAGG
GATGCTAATAGTGTGCCCCTAGCAAGTGCATATGGCCTTGCAAAACACAGGGATGGACGC
TGGGAGTGGGCAATCGCCCCTGGTGTCTCTCCATCACCCAGATATCAACATGCAGCTGTT
TTCGTCAATGCACGACTTCATGTCTCAGGAGGGGCCCTTGGAGGCGGTCGCATGGTTGAA
GACTCCTCAAGTGTTGCAGTGTTGGATACTGCTGCTGGAGTGTGGTGTGATACAAAATCA
GTAGTTACTACTCCAAGGACAGGAAGATATAGTGCAGATGCTGCAGGCGGTGATGCTTCT
GTAGAGCTTACACGACGGTGCAGGCATGCAGCTGCTGCAGTTGGTGATATGATATATGTT
TATGGAGGTCTACGGGGAGGTGTGCTGCTAGATGACCTTCTTGTTGCCGAAGATCTTGCT
GCTGCTGAAACAACAAATGCAGCAAATCAGGCAGCTGCAATTGCTGCAGCCTCTGACATA
CAAGCTGGAAGAGAACCTGGTAGGTATGCCTACAATGATGAACAAACAGGGCAGCCAGCT
ACAATAACATCTCCTGATGGAGCTGTGGTTCTTGGAACTCCAGTTGCTGCTCCCGTTAAT
GGGGACATGTATACTGATATTAGCCCTGAGAACGCTGTGATCCAGGGACAAAGGAGAATG
AGCAAAGGTGTTGATTATTTGGTTGAAGCATCTGCTGCAGAGGCTGAGGCAATCAGTGCT
ACTTTAGCTGCTGTAAAAGCTCGGCAAGTTAATGGTGAGGCAGAGCATTCACCTGACAGG
GAGCAGTCTCCAGATGCCACACCAAGTGTGAAGCAAAATGCAAGCCTGATAAAACCAGAC
TATGCTCTTTCAAATAATTCAACACCACCTCCTGGGGTTCGGTTACACCATAGAGCAGTT
GTGGTAGCAGCAGAAACCGGAGGTGCCTTAGGTGGCATGGTTAGGCAGCTCTCAATTGAC
CAGTTTGAAAATGAAGGAAGAAGGGTCATCTATGGCACTCCTGAGAGTGCAACTGCAGCA
AGGAAGTTGCTAGATCGGCAAATGTCTATTAATAGTGTACCTAAAAAGGTAATTGCATCC
CTCTTGAAACCTCGTGGTTGGAAGCCCCCTGTGCGAAGGCAGTTCTTTTTGGACTGCAAT
GAGATTGCAGACCTATGTGATAGTGCGGAAAGAATATTTTCAAGTGAACCAAGTGTCCTA
CAGCTTAAAGCTCCAATTAAGATATTTGGTGATTTGCACGGTCAATTTGGTGACCTAATG
CGCTTGTTTGATGAGTACGGTGCTCCTTCGACAGCTGGAGACATTGCTTACATTGATTAC
CTCTTCTTGGGAGATTACGTGGATCGTGGTCAGCATAGTTTGGAGACAATCACTCTTCTC
CTTGCACTTAAGGTTGAATATCCTCTTAATGTACATTTGATTCGAGGGAATCATGAGGCC
GCTGATATCAATGCTTTGTTTGGGTTCCGAATAGAGTGCATAGAGCGAATGGGTGAGCGT
GATGGGATCTGGACCTGGCATCGCATGAATAGGCTATTTAATTGGCTTCCTTTGGCTGCC
CTAATAGAGAAGAAAATAATATGTATGCATGGTGGTATTGGCCGGTCTATCAATCATGTT
GAACAAATTGAGAATCTTCAAAGACCAATTACCATGGAAGCAGGCTCGGTTGTTCTAATG
GATCTTCTGTGGTCTGATCCAACTGAAAATGATAGTGTTGAAGGACTTAGACCAAATGCC
CGTGGCCCAGGCCTTGTTACCTTTGGGCCGGATCGTGTTATGGAGTTCTGCAACAACAAT
GACTTACAGTTAATTGTGCGAGCACATGAGTGTGTGATGGATGGTTTTGAGCGTTTTGCT
CAAGGTCACCTAATCACTCTCTTCTCAGCAACAAATTACTGTGGTACGGCAAACAATGCG
GGTGCAATCTTGGTTCTAGGAAGAGATCTTGTAGTAGTTCCGAAACTCATCCATCCTTTG
CCGCCTGCCATTACATCTCCCGAGACCTCTCCAGAGCATCATCTTGAGGACACATGGATG
CAGGAACTAAATGCCAACAGGCCGCCAACTCCAACAAGGGGCCGCCCTCAAGCAGCAAAC
AATGACCGAGGCTCTCTTGCATGGATATAG

Protein

1010 aa

>Os12t0617900-02 Similar to Serine/threonine protein phosphatase BSL2 (EC 3.1.3.16) (BSU1-like protein 2).
MDVDSRMTTESDSDSDAAAQGGGGGGFGSETSSASPSAPGTPTAMGAGGGAAPIAAAAIA
AAASAAVVAGPRPAPGYTVVNAAMEKKEDGPGCRCGHTLTAVPAVGEEGAPGYVGPRLIL
FGGATALEGNSATPPSSAGSAGIRLAGATADVHCYDVSSNKWSRLTPVGEPPSPRAAHVA
TAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRF
LLTIGGNDGKRPLADVWALDTAAKPYEWRKLEPEGEGPPPCMYATASARSDGLLLLCGGR
DANSVPLASAYGLAKHRDGRWEWAIAPGVSPSPRYQHAAVFVNARLHVSGGALGGGRMVE
DSSSVAVLDTAAGVWCDTKSVVTTPRTGRYSADAAGGDASVELTRRCRHAAAAVGDMIYV
YGGLRGGVLLDDLLVAEDLAAAETTNAANQAAAIAAASDIQAGREPGRYAYNDEQTGQPA
TITSPDGAVVLGTPVAAPVNGDMYTDISPENAVIQGQRRMSKGVDYLVEASAAEAEAISA
TLAAVKARQVNGEAEHSPDREQSPDATPSVKQNASLIKPDYALSNNSTPPPGVRLHHRAV
VVAAETGGALGGMVRQLSIDQFENEGRRVIYGTPESATAARKLLDRQMSINSVPKKVIAS
LLKPRGWKPPVRRQFFLDCNEIADLCDSAERIFSSEPSVLQLKAPIKIFGDLHGQFGDLM
RLFDEYGAPSTAGDIAYIDYLFLGDYVDRGQHSLETITLLLALKVEYPLNVHLIRGNHEA
ADINALFGFRIECIERMGERDGIWTWHRMNRLFNWLPLAALIEKKIICMHGGIGRSINHV
EQIENLQRPITMEAGSVVLMDLLWSDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNN
DLQLIVRAHECVMDGFERFAQGHLITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPL
PPAITSPETSPEHHLEDTWMQELNANRPPTPTRGRPQAANNDRGSLAWI*

5'UTR

chr12:26315454..26315532 (- strand) : 79 bp

CDS

chr12:26315024..26315453 (- strand) : 430 bp

chr12:26314035..26314095 (- strand) : 61 bp

chr12:26313786..26313864 (- strand) : 79 bp

chr12:26313625..26313704 (- strand) : 80 bp

chr12:26313447..26313541 (- strand) : 95 bp

chr12:26313246..26313345 (- strand) : 100 bp

chr12:26312653..26312722 (- strand) : 70 bp

chr12:26311972..26312073 (- strand) : 102 bp

chr12:26311786..26311867 (- strand) : 82 bp

chr12:26311199..26311378 (- strand) : 180 bp

chr12:26310424..26310697 (- strand) : 274 bp

chr12:26310049..26310292 (- strand) : 244 bp

chr12:26309677..26309847 (- strand) : 171 bp

chr12:26309230..26309468 (- strand) : 239 bp

chr12:26308839..26308923 (- strand) : 85 bp

chr12:26308643..26308741 (- strand) : 99 bp

chr12:26308363..26308562 (- strand) : 200 bp

chr12:26308199..26308274 (- strand) : 76 bp

chr12:26307972..26308107 (- strand) : 136 bp

chr12:26307746..26307885 (- strand) : 140 bp

chr12:26307562..26307648 (- strand) : 87 bp

3'UTR

chr12:26306869..26307561 (- strand) : 693 bp

FASTA

>Os12t0617900-02 class=Sequence position=chr12:26306869..26315532 (- strand)
GTGTGTGTGT TGCGTGGTGG GGAGGAAGAT CTCGAGCGGT TGGAAACCCT AGTGGGGAGG GAGGGAGTGG GCGGGGGGGA
TGGACGTGGA CTCGAGGATG ACGACGGAGT CGGACTCCGA CTCGGACGCC GCGGCGCAGG GGGGAGGAGG AGGAGGGTTC
GGGAGCGAGA CCTCCTCGGC GTCGCCCTCG GCGCCCGGGA CGCCGACGGC TATGGGGGCA GGAGGGGGAG CTGCTCCTAT
CGCTGCTGCT GCTATCGCTG CCGCCGCGTC GGCGGCGGTG GTGGCGGGCC CGAGGCCCGC GCCGGGGTAC ACGGTGGTGA
ACGCGGCGAT GGAGAAGAAG GAGGACGGGC CCGGGTGCCG GTGCGGCCAC ACGCTCACCG CGGTGCCGGC CGTCGGGGAG
GAGGGCGCGC CGGGGTACGT GGGGCCGCGG CTGATCCTCT TCGGCGGTGC CACCGCGCTC GAGGGGAACT CCGCCACGCC
GCCATCCTCG GCCGGGAGCG CCGGAATCCG TAATGCCCTT TTAAACCTCA GCTGCTCTTG TTTTCATGTA TGGTTTGGGG
GGATGGTGTT GGCGTGCTAA TTGTTTAGTT TGCTGTCGAC GAGAGCCAAA CTCCATGGGA GTTGGAATAC TTGGGTTTGT
ACTGAATCTT GCTCGGGACT TTGGAGTGAT ATGCTGGTTC GCGTACCGAC TGATTTAGGG ATATAACTTA CTGTTCGGGA
TAGCAGCTAG AGTTGATTGT AGCTCTGGTG TTTCAGTGTC TTAGTTAGAG GTAGAATTCG GAGCATCTGC TGATGGTGGT
ATTGCTAGTG TAGGCTGGAT TAGGTTAAAA ACTCGTACTG GGAGGGATTT TCATGTTCTG CCTGGTTAGG AAAGCGATTA
TGAGTGGCAC GTTATGACAA TATATGCAGT GTAACTCATG TGCACATGCT GTTAATTGGA GGGCCAAATA TGGTGCTCTT
TTATGATTTG AGGCACAAGA TTTATTTAAT GAACAACGAT ACTCGCATAC TTCTGTTGCG GTGAAGTACC AGTTCCTTTT
AATGTTTGTT GGTTGTTTCC TTTGGATTAT GATTGTCTTT GTATGTTAGA AGAAGCACTC AAAGGTTTCA AATTGGAAAA
ACATTTATGT GCTTAGACTG TACTGATGCC CTTGGATACC CTAGGGCCTA GGTTAAGGCG TATGGGTTAA TTAATTAGGT
GAACTATGCC GTTTCAAAAG TTAAGCCTGA AATGCTATTA TACGCATTCC GGTTCTCCAA GTCTTATTGG GGGATTAGAC
GTTTTGGTAG ACCGGGTGCC AAATGTATTG TTTCAAAACT GAGCTTAGAA ATGTTGGAGG TTTTGCTTGT GATGAAAGGG
AAAGTTTATC TTCTTTATAG GCAAATCAGC AAAATTGACA AGATCTTACA TAAAATTATC AATCTCCTTT CTTGCAGGTC
TTGCTGGTGC TACTGCGGAT GTGCACTGCT ACGATGTTTC ATCGAATAAG TGGAGCAGGT ATGTTCTTTT TAGTAAGAGC
CTTTTTTAGT AAATGTTTTA ATTCCTTTGG ATATTATGCT TGGATGCCAT GTGTAAGTTT TTCTTTAGAT CCCATGAAAT
TTTATCTCAA TTGCACTTGT TAGTTCTGTG CACTACTACA TTTGATTGAC CACAGTAAAT GTTGTCAGGC TTACTCCAGT
TGGTGAACCT CCTTCACCAA GAGCGGCACA TGTAGCGACT GCTGTTGGCA CCATGGTGGT CATTCAGGTA GCTTTAATCT
TTTTGCCTTA GAGTAGTAGC TATGTCAGTT TTATCGTCAG GCCAGCACTA ACCTGCTCTC AACTACAGGG TGGGATAGGT
CCTGCTGGTT TATCTGCAGA AGACCTTCAT GTTCTGGATC TTACACAACA ACGACCGCGA TGGCACAGGT GGCTGCTGCT
CTAATTTCGT TTGGGTTTAG AATATGCTTT TGCTGCTATC CCTAGTGAGC ATTATCATGT CTTGTATGTA GAGTGGTGGT
TCAAGGGCCT GGCCCTGGTC CTCGATATGG ACATGTGATG GCTTTGGTTG GGCAGCGTTT CTTGTTGACA ATCGGTGGAA
ATGATGGTAG GAGATTGCTT ATGTGCCTAT GAAACCTAGA TTTTGGCTAC TTAAGATATT GTTCCATCCC AAATGATGTT
GATACTAAGA GTGAATAAAT GTTTCAGGGA AGAGGCCCCT GGCTGATGTG TGGGCCCTTG ATACAGCAGC TAAGCCATAT
GAGTGGAGGA AACTTGAACC AGAAGGTGAA GGACCACCCC CATGCATGTA AGTGTGCAGA TAATAAAAAA GGAAACATCT
CCCCTTTGAA ATCTAGATCA ACGAGGTTCT TTGGTGATGT TGAGTTTAAA TCTTGCTATT TTCTTGGCAA GATTCCCCAG
CTACATCCAT GAGCCAACAT ATGATAATGC CTATATTTTC TAATGAAGCT TTCAGTGATT GTACTTTTGT TTGATGCCCA
TATCATATAT AGTAACCTGT TTTGGCACCA TTAGACTACT TTTAGGGCTC CACTTTCTTT TGTTGGCCAA GAAGTTACAG
AAAACTTTGG TTATTTACAA CTCAATATTG ATAGTTTGTT CAAAAGCAAC TGCCAATTAA GAACAAGCTA CAAGTGTTTC
GTTAAGTCTA CTTGGATGCA GAACACAGTA AAGTGTCAAA CCTAATATCC TAGGGTAACC CACCACTAGC TATTTTCTGT
AATTTCACTT ACGCTTTTCA ATAGATTGCT AGAAGTTGAG ATAGTTTTTG TATACTTCTA ATAGTCTGTG CCTCTGGTAA
TGTTGCTCAG GTATGCAACT GCAAGTGCCC GTTCTGATGG ACTTCTATTA CTCTGTGGTG GGAGGGATGC TAATAGTGTG
GTAAGTACCA TTCTATTTGT GAATAGCTTT TGCTGAGGAA ATTTTGTTCT AATAGGAATA TAGGGTTGAA ATTCTCTGTT
CTTAGTTTTT AGATTTGAAT CTGCTCTGAA GTCATAACAC GAGAATGGTT CATATAGCTT TTTTGGTAAG TGATATTTAT
AAGCATTGCA TGCTTGTGCC AACAAAGCAT ATTTATTTTT TCTCATGTTA CATCTGCTTC TTTGGATGAG TGAGGAATTG
TGATGTTAAG TGCACTGAAT CCATATGGCA TGCTTGAAAG GCCTGTTTTG TTCAATTTCA CTTGTAAAGC CATGCCCTGC
AAATAAAAAA AATAGAATCG TCTGGGCTGG AAACTGAATA TGGATTCAAC CGATTAGTTT TCATTAGATG GTAAGTGATT
AGCATTTTGT AGGTGAATTG AAATAAGGAT ATATATGGAC TTTTCTTTTT GGTAATTACG ATTTTGGAGA GGCAGTGACT
TCTATTTGTA TGTCCTACAC TGTTTTACTC CAAGGCTCAA GCATATTTGT CAAAGCTAAC TATGTAGTTT TTCCTTTTCT
TTTGGGCTAA AACCATCAGC CCCTAGCAAG TGCATATGGC CTTGCAAAAC ACAGGGATGG ACGCTGGGAG TGGGCAATCG
CCCCTGGTGT CTCTCCATCA CCCAGATATC AACATGCAGC TGTGAGTTGT GAATATCCTT TCCCTTCAAT TTTCTTTATT
TTTCATCTTG AGATGGATCC CACTGCATGG TTTGTGTCAT GTTTTATTTC CTTTTGTTTC TTTAGGTTTT CGTCAATGCA
CGACTTCATG TCTCAGGAGG GGCCCTTGGA GGCGGTCGCA TGGTTGAAGA CTCCTCAAGT GTTGCAGGTT CCTTACTATT
ATTTGCTTTG TATACTTTGC ACCTGTTAGT TCATGTGGCA TCCTTTTGAA AAATCTCCCA CCTTTTGTGG CAACTCGAAA
CATTTCAAGC AATTTCTTTT GATTGTAAGT AGGATAAAGA CCATATATGA TTAATTATTT CAATTACTAA GTTCAATATA
TTGTTTTCTG TTTGCTAAAT TACCCATTTA CAATTCATCA GCAGAGAACA AGATGCATGC TGTTATTGAT TGTCTCTGCA
GTTCATATAT CTTGTATTAT TGAAAAAAGT AAATGGTCTG AATAATACTG GAACACAGTC GGTAGTTTAA GCATTGGCCA
GTTGGTCTTA GTATGCATGT ATATTTTCTT GTTTCCCTAG GTTCTTATTT TTAAGCCATG CTGCCCTTTT TCAGTGTTGG
ATACTGCTGC TGGAGTGTGG TGTGATACAA AATCAGTAGT TACTACTCCA AGGACAGGAA GATATAGTGC AGATGCTGCA
GGCGGTGATG CTTCTGTAGA GCTTACACGA CGGTGCAGGC ATGCAGCTGC TGCAGTTGGT GATATGATAT ATGTTTATGG
AGGTCTACGG GGAGGTAAGA CACTTCAGTT TCTTAGCCTC ATCTGATTTC TGACACCAAT TCTCATGTTT GAATTGCGAT
CCGCTGTCCT ATGAGTCCTG TTCAGCTGTA TTCAGCAGCA CACGTTTTTT AAGTAGTAAA GATGTTATCC GATGAGGAAC
ATGTATATTC TTTCTGGGAA GATAAGGAAT TTAGGATATT AAGATATCAG TACAAATTTA ATTAGCATTG ACTATGTTTA
CATAGCAGAT CCAAAAGGTT TTTAAGGTGA TCCGGATTTC AGCTTAATGG ATTTCCAATT AACATTAGTA TTATTACAAT
ATCCTTATCT GAATGAAAAA CTACTCCTGG AGCTAACTGT TAACTAACTT TTTACACTTG CATCACTTTT TTGAGGGTTG
ACTTTGGGTT ATCAGAGCGA AATTGCCTCC TATTCAAATT AGGATATATT CATATTTTTG TTGATGCTAA GTTTTGTATA
GTTGCAATTC TAAATTCCCT TTATTGTTAC TCCAGGTGTG CTGCTAGATG ACCTTCTTGT TGCCGAAGAT CTTGCTGCTG
CTGAAACAAC AAATGCAGCA AATCAGGCAG CTGCAATTGC TGCAGCCTCT GACATACAAG CTGGAAGAGA ACCTGGTAGG
TATGCCTACA ATGATGAACA AACAGGGCAG CCAGCTACAA TAACATCTCC TGATGGAGCT GTGGTTCTTG GAACTCCAGT
TGCTGCTCCC GTTAATGGGG ACATGTATAC TGATATTAGC CCTGAGAACG CTGTGATCCA GGGACAAAGG TTTGTAAAAT
TTCGTAGACA TGTTCCGATA GTTTTTATTT TATTTTATTT TATTTTTTTT GCATATCTAT CAGTCTATTG AGTAGAAGCT
ACATGCACTG AAATGTGTCT TTTGGTCTTG ATTTGCACAG GAGAATGAGC AAAGGTGTTG ATTATTTGGT TGAAGCATCT
GCTGCAGAGG CTGAGGCAAT CAGTGCTACT TTAGCTGCTG TAAAAGCTCG GCAAGTTAAT GGTGAGGCAG AGCATTCACC
TGACAGGGAG CAGTCTCCAG ATGCCACACC AAGTGTGAAG CAAAATGCAA GCCTGATAAA ACCAGACTAT GCTCTTTCAA
ATAATTCAAC ACCACCTCCT GGGGTTCGGT TACACCATAG AGCAGTAAGT AGAAAATGCA GTTAGTTTTA CCGAGTTAAT
TCGTTACTTT ATTTGCTTCT CTAGTTAATT GATAAATTCA AAACCAGATC ATGATCTTTC CTTGTTCTAC TGTTGAAATA
TATTGTATTA CAGAAGCTGT CCCTGAACAA CCTAGCTCAA GTTAGTTACA GCATTGTGAA CTTTATTTTT TTCTTGCTCT
TGTAGGTTGT GGTAGCAGCA GAAACCGGAG GTGCCTTAGG TGGCATGGTT AGGCAGCTCT CAATTGACCA GTTTGAAAAT
GAAGGAAGAA GGGTCATCTA TGGCACTCCT GAGAGTGCAA CTGCAGCAAG GAAGTTGCTA GATCGGCAAA TGTCTATTAA
TAGTGTACCT AAAAAGGTAT CTTACTTTGC AGATGTAATT TGACAAAAAA AAACAGCAAA CAATTGCATG ATTATCTGCT
AAAACACTAA GGCAATGGCA TACACTGGTG TGTGTTGTTG TCAGGGGGCA TAAATGGAAG TCATGATAAC CTTTGCCTTT
AAACTTCTAT GCTATTGTGC TATTAAGTAC TCACATATTT CTATTTGATG ACAAAATTAT TCAGGTAATT GCATCCCTCT
TGAAACCTCG TGGTTGGAAG CCCCCTGTGC GAAGGCAGTT CTTTTTGGAC TGCAATGAGA TTGCAGACCT ATGTGATAGT
GCGGAAAGAA TATTTTCAAG TGAACCAAGT GTCCTACAGC TTAAAGCTCC AATTAAGATA TTTGGTGATT TGCACGGTCA
ATTTGGTGAC CTAATGCGCT TGTTTGATGA GTACGGTGCT CCTTCGACAG CTGGAGACAT TGCGTGAGTA TTTTCTGATT
TTGAACTGCC CTGATTCATT TACTTATTCA TTCCAATTTT GGGAACTTTT ATGGCATTTT ATTGGATGAC AAAGCTGAAA
AACCTTTTTT TTTTCAAAAA AGAACCTCTA GAACACTTTA TGTTAAGTTG TTTTATTTTC AGTTATATTA TTGATACTTT
ATCTGAACTT CTTGATTTGC GTATATAGGC TTTGGGTTAG AAAATGTTCG GTTAGAGGAG ATATTTTCAA TCGATCTTTC
CTGACTTATA TGTTTTCCTT TTGTTTTTTT TGTTCAAAAA ACTTTGCAGT TACATTGATT ACCTCTTCTT GGGAGATTAC
GTGGATCGTG GTCAGCATAG TTTGGAGACA ATCACTCTTC TCCTTGCACT TAAGGTAAAG TTGTGAACAA CTGAGCGAAC
CCTGAAAAAG TGCTATTTCA GCAGACAGTT CTTTTTCTCT CAAAAATGTA ACAATTGATC TTATAATTCA GGTTGAATAT
CCTCTTAATG TACATTTGAT TCGAGGGAAT CATGAGGCCG CTGATATCAA TGCTTTGTTT GGGTTCCGAA TAGAGTGCAT
AGAGCGAATG GTAATGACCA TGTTGCATTC TGACATTCTT ATTAGGCTGT TTTTTATCTC TTGCTTATCA CTGTTCTTTG
CTAAAAACAG GGTGAGCGTG ATGGGATCTG GACCTGGCAT CGCATGAATA GGCTATTTAA TTGGCTTCCT TTGGCTGCCC
TAATAGAGAA GAAAATAATA TGTATGCATG GTGGTATTGG CCGGTCTATC AATCATGTTG AACAAATTGA GAATCTTCAA
AGACCAATTA CCATGGAAGC AGGCTCGGTT GTTCTAATGG ATCTTCTGTG GTCAGCATTT CAATAGCTCT TTGATACTAC
TATTGCAAGA TTGTTCTTTA TTTTTCCCTG ATATAACCTA TTTTTTAAAT CTTAAAAGGT CTGATCCAAC TGAAAATGAT
AGTGTTGAAG GACTTAGACC AAATGCCCGT GGCCCAGGCC TTGTTACCTT TGGGGTTAGT ATTCTCTGTG TAATGTTGTG
TCCAGCTCTT TTCTCCCTGT TGGTTCGTGT GGTTTCTGTC AAAATAACAC GTATTGTAAC TGCAGCCGGA TCGTGTTATG
GAGTTCTGCA ACAACAATGA CTTACAGTTA ATTGTGCGAG CACATGAGTG TGTGATGGAT GGTTTTGAGC GTTTTGCTCA
AGGTCACCTA ATCACTCTCT TCTCAGCAAC AAATTACTGT GGTAATGATA TGCTATTCTG ACTTGGTCTG TTCGCGATTA
TCTCTTCAAG TTTGATTGTC CTGTTACTTA ATATGATATG TATGCAGGTA CGGCAAACAA TGCGGGTGCA ATCTTGGTTC
TAGGAAGAGA TCTTGTAGTA GTTCCGAAAC TCATCCATCC TTTGCCGCCT GCCATTACAT CTCCCGAGAC CTCTCCAGAG
CATCATCTTG AGGACACATG GATGCAGGTA ACTCCTCTTT TATCATGTGA TGCTCTTGGA TTTGCAATAG GGTATTCCTG
TCTATACGCT TCTAAGTTCT AACACCATCT TGTGTTAAAA TCAGGAACTA AATGCCAACA GGCCGCCAAC TCCAACAAGG
GGCCGCCCTC AAGCAGCAAA CAATGACCGA GGCTCTCTTG CATGGATATA GTAGCTTTGG CATGCGCTGA ATTTATTCAT
TCCAAGTCCT CATCATTGGG TTCTGGCTAA GCTACATTTA TCCGTTCTGC ACAGAGGCAG ACGATCTGTG CTCAAGAGAC
GTGCTAGCCC ACAACAATTG CCAACTTGGA GGTCGTTTGC AGAGGAGAGC TAAGCTACAG AAAGAACCAA GGGTGGAGAA
ACTTCGCCAA TCACCACCGA CAGCGCTCTC CAATTTCTTT TCCCAAATCA TGAGAAGTAA ATGAACATAT TCTTGGTCGT
TCATCGGAAG ATCCTACCTG CGAGGCTTCG CCCCTGTATA TACTCAGATG ATGCCCCAGC GGATAGGTGA GTGGGGTGTA
TGTGTTTTGG TCAACCGATT TGAGGAACAG AAGGGATAGT GTAACTAGTG GTTATTGTAC TAGGTATTCT TTTCCTGTGT
CTAGATTTTG TTTTTACCAT GTTGGAAAAG TATTGGAGTG GCCAAAGGAG TAAACTTATT GGATGGGGTC CATCTAGTTG
TTGTATAATA GCTGTCTCAC CTATTTGTGT TATCACGCCT TCCTCCCATT TGTAATACTA CCTGTCTCTG GTGCTGACAT
GATGTACAAT ATTATCCTTG TCGTCAAAAT TTTGTGTAGT GAACAAAGTT GGTGATTGTT TGATTTGTTA GGGGTGGTAA
GAGCAGCCTT GTATTGTACT GTCC

Locus: Os12g0617900

Loading...

Locus: Os12g0617900

Loading...