Os12t0617900-03

Locus

Os12g0617900

Description

Similar to Serine/threonine protein phosphatase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPPKL3, OsPP132

Oryzabase Gene Name Synonym(s)

protein phosphatase with Kelch-like repeat domain 3, Protein phosphatase 132

Transcript Evidence

AK062131 (DDBJ, Best hit)

Protein Evidence

B9FTT3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: hydrolase activity (GO:0016787)

Functional domain (InterPro)

Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatase (IPR006186)

Full-length cDNA

001-045-E05 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0617900-03)

RiceXPro (AK062131)

Others

Oryzabase (11679)

KEGG (Os12t0617900-03 (EC:3.1.3.16))

Transcript

1102 bp

>Os12t0617900-03 Similar to Serine/threonine protein phosphatase.
AGGCTCGGTTGTTCTAATGGATCTTCTGTGGTCTGATCCAACTGAAAATGATAGTGTTGA
AGGACTTAGACCAAATGCCCGTGGCCCAGGCCTTGTTACCTTTGGGCCGGATCGTGTTAT
GGAGTTCTGCAACAACAATGACTTACAGTTAATTGTGCGAGCACATGAGTGTGTGATGGA
TGGTTTTGAGCGTTTTGCTCAAGGTCACCTAATCACTCTCTTCTCAGCAACAAATTACTG
TGGTACGGCAAACAATGCGGGTGCAATCTTGGTTCTAGGAAGAGATCTTGTAGTAGTTCC
GAAACTCATCCATCCTTTGCCGCCTGCCATTACATCTCCCGAGACCTCTCCAGAGCATCA
TCTTGAGGACACATGGATGCAGGAACTAAATGCCAACAGGCCGCCAACTCCAACAAGGGG
CCGCCCTCAAGCAGCAAACAATGACCGAGGCTCTCTTGCATGGATATAGTAGCTTTGGCA
TGCGCTGAATTTATTCATTCCAAGTCCTCATCATTGGGTTCTGGCTAAGCTACATTTATC
CGTTCTGCACAGAGGCAGACGATCTGTGCTCAAGAGACGTGCTAGCCCACAACAATTGCC
AACTTGGAGGTCGTTTGCAGAGGAGAGCTAAGCTACAGAAAGAACCAAGGGTGGAGAAAC
TTCGCCAATCACCACCGACAGCGCTCTCCAATTTCTTTTCCCAAATCATGAGAAGTAAAT
GAACATATTCTTGGTCGTTCATCGGAAGATCCTACCTGCGAGGCTTCGCCCCTGTATATA
CTCAGATGATGCCCCAGCGGATAGGTGAGTGGGGTGTATGTGTTTTGGTCAACCGATTTG
AGGAACAGAAGGGATAGTGTAACTAGTGGTTATTGTACTAGGTATTCTTTTCCTGTGTCT
AGATTTTGTTTTTACCATGTTGGAAAAGTATTGGAGTGGCCAAAGGAGTAAACTTATTGG
ATGGGGTCCATCTAGTTGTTGTATAATAGCTGTCTCACCTATTTGTGTTATCACGCCTTC
CTCCCATTTGTAATACTACCTGTCTCTGGTGCTGACATGATGTACAATATTATCCTTGTC
GTCAAAATTTTGTGTAGTGAAC

CDS

468 bp

>Os12t0617900-03 Similar to Serine/threonine protein phosphatase.
GGCTCGGTTGTTCTAATGGATCTTCTGTGGTCTGATCCAACTGAAAATGATAGTGTTGAA
GGACTTAGACCAAATGCCCGTGGCCCAGGCCTTGTTACCTTTGGGCCGGATCGTGTTATG
GAGTTCTGCAACAACAATGACTTACAGTTAATTGTGCGAGCACATGAGTGTGTGATGGAT
GGTTTTGAGCGTTTTGCTCAAGGTCACCTAATCACTCTCTTCTCAGCAACAAATTACTGT
GGTACGGCAAACAATGCGGGTGCAATCTTGGTTCTAGGAAGAGATCTTGTAGTAGTTCCG
AAACTCATCCATCCTTTGCCGCCTGCCATTACATCTCCCGAGACCTCTCCAGAGCATCAT
CTTGAGGACACATGGATGCAGGAACTAAATGCCAACAGGCCGCCAACTCCAACAAGGGGC
CGCCCTCAAGCAGCAAACAATGACCGAGGCTCTCTTGCATGGATATAG

Protein

156 aa

>Os12t0617900-03 Similar to Serine/threonine protein phosphatase.
GSVVLMDLLWSDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMD
GFERFAQGHLITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHH
LEDTWMQELNANRPPTPTRGRPQAANNDRGSLAWI*

5'UTR

chr12:26308392..26308392 (- strand) : 1 bp

CDS

chr12:26308363..26308391 (- strand) : 29 bp

chr12:26308199..26308274 (- strand) : 76 bp

chr12:26307972..26308107 (- strand) : 136 bp

chr12:26307746..26307885 (- strand) : 140 bp

chr12:26307562..26307648 (- strand) : 87 bp

3'UTR

chr12:26306929..26307561 (- strand) : 633 bp

FASTA

>Os12t0617900-03 class=Sequence position=chr12:26306929..26308392 (- strand)
AGGCTCGGTT GTTCTAATGG ATCTTCTGTG GTCAGCATTT CAATAGCTCT TTGATACTAC TATTGCAAGA TTGTTCTTTA
TTTTTCCCTG ATATAACCTA TTTTTTAAAT CTTAAAAGGT CTGATCCAAC TGAAAATGAT AGTGTTGAAG GACTTAGACC
AAATGCCCGT GGCCCAGGCC TTGTTACCTT TGGGGTTAGT ATTCTCTGTG TAATGTTGTG TCCAGCTCTT TTCTCCCTGT
TGGTTCGTGT GGTTTCTGTC AAAATAACAC GTATTGTAAC TGCAGCCGGA TCGTGTTATG GAGTTCTGCA ACAACAATGA
CTTACAGTTA ATTGTGCGAG CACATGAGTG TGTGATGGAT GGTTTTGAGC GTTTTGCTCA AGGTCACCTA ATCACTCTCT
TCTCAGCAAC AAATTACTGT GGTAATGATA TGCTATTCTG ACTTGGTCTG TTCGCGATTA TCTCTTCAAG TTTGATTGTC
CTGTTACTTA ATATGATATG TATGCAGGTA CGGCAAACAA TGCGGGTGCA ATCTTGGTTC TAGGAAGAGA TCTTGTAGTA
GTTCCGAAAC TCATCCATCC TTTGCCGCCT GCCATTACAT CTCCCGAGAC CTCTCCAGAG CATCATCTTG AGGACACATG
GATGCAGGTA ACTCCTCTTT TATCATGTGA TGCTCTTGGA TTTGCAATAG GGTATTCCTG TCTATACGCT TCTAAGTTCT
AACACCATCT TGTGTTAAAA TCAGGAACTA AATGCCAACA GGCCGCCAAC TCCAACAAGG GGCCGCCCTC AAGCAGCAAA
CAATGACCGA GGCTCTCTTG CATGGATATA GTAGCTTTGG CATGCGCTGA ATTTATTCAT TCCAAGTCCT CATCATTGGG
TTCTGGCTAA GCTACATTTA TCCGTTCTGC ACAGAGGCAG ACGATCTGTG CTCAAGAGAC GTGCTAGCCC ACAACAATTG
CCAACTTGGA GGTCGTTTGC AGAGGAGAGC TAAGCTACAG AAAGAACCAA GGGTGGAGAA ACTTCGCCAA TCACCACCGA
CAGCGCTCTC CAATTTCTTT TCCCAAATCA TGAGAAGTAA ATGAACATAT TCTTGGTCGT TCATCGGAAG ATCCTACCTG
CGAGGCTTCG CCCCTGTATA TACTCAGATG ATGCCCCAGC GGATAGGTGA GTGGGGTGTA TGTGTTTTGG TCAACCGATT
TGAGGAACAG AAGGGATAGT GTAACTAGTG GTTATTGTAC TAGGTATTCT TTTCCTGTGT CTAGATTTTG TTTTTACCAT
GTTGGAAAAG TATTGGAGTG GCCAAAGGAG TAAACTTATT GGATGGGGTC CATCTAGTTG TTGTATAATA GCTGTCTCAC
CTATTTGTGT TATCACGCCT TCCTCCCATT TGTAATACTA CCTGTCTCTG GTGCTGACAT GATGTACAAT ATTATCCTTG
TCGTCAAAAT TTTGTGTAGT GAAC

Locus: Os12g0617900

Loading...

Locus: Os12g0617900

Loading...