Os12t0618600-01

Locus

Os12g0618600

Description

Similar to Transcriptional activator HAP2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP2F

CGSNL Gene Name

HAP2 SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP2F, NF-YA, CBF-B, NF-YA10, OsNF-YA10, NFYA10

Oryzabase Gene Name Synonym(s)

NUCLEAR FACTOR-Y subunit A10, NUCLEAR FACTOR-Y subunit NF-YA10, NF-YA transcription factor 10, NF-YA subunit 10, NF-YA family 10

Transcript Evidence

AK073742 (DDBJ, Best hit)

Protein Evidence

B6SM21 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Functional domain (InterPro)

CCAAT-binding transcription factor, subunit B (IPR001289)

Full-length cDNA

J033067G24 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0618600-01)

RiceXPro (AK073742)

Others

Oryzabase (8478)

KEGG (Os12t0618600-01)

Transcript

1639 bp

>Os12t0618600-01 Similar to Transcriptional activator HAP2.
GCTGCTGCTGAAAGCCTGATGAAATTGGGTGATTAGGTGCTTAACATAATCCCAATCCTA
GAAAAATACATTCGGAGTGGTTGCTGCTGAGCTCAACCAATCAAGCTTGTTGGGGAGGCA
AGCAGTCACAATGATGAGCTTCAACAAGAGCCAAGAAGGATTTGGGCAGGTTGCTGCTGT
GGCCACCCTGGCCTCCAATGGAGGAGGCTCTCTACCATGGCTGCTGTACGGCGAGCCACT
GGGGCAGGGGAAGCCGGCCATGTCGCCGGAGGGCGTGGTGCCGAGAGCACAGACTCCTCT
GGATCCTCCTCAGGTTCCAGCCATGGACAGGGGTGTCCCTGAAATTCTGAACTTCTCCAT
GGTTCCAGGTAAAGGAGAAAAATGTTCTGAGCACTCAACTACTATTGCTCTGCAGTCACC
ATTTGCAGAATATAATGGCTGTTTTGAGCTGGGCCTTGGTCAATCTGTGGTTCCCTCTAA
TTATCCTTATGCTGACCAGCACTATGGCCTACTTTCTCCTTATGGAGTGAGACCAACGCC
TAGCGGGCGAATTCTTATTCCACCAAATATGCCAGCTGATGCACCAATTTATGTGAATGC
AAAACAGTGTTCAGCCATCATTCGACGTCGCCATGCTCGTGCCAAGGCAGAGAGGGAGAA
TAGGCTGGTCAAAGCTAGAAAACCATATCTTCACGAATCACGCCATCTTCATGCAATGCG
TCGTGCAAGAGGCTCTGGTGGGCGCTTCCTCAACACGAAGAAAGAGACCAATGGGAAAAC
CACTGGTGGAGGCAGGAAGGTGATGGACATCATCATCCCGCCTCTGTGCCCCGCCGCATC
TCCCAGCTCGGAGCAGTGCAACCCAAGCAGCGTTTCCAGCCTGTCCGGGTCAGAGGTGTC
GAGCATATATGAACACGAAGACATGGACCACTTCCATAGCTTTGATCATCTCCGGACACA
CTTCTTCACCCCGCTCCCGAGCCTCATGGATGTCGAGCACGGGGCTGGTAACCCCTTCAA
GTGGACAGCAGCCTCTGATGGCTGCTGTGACCTCCTCAAAGCATGACTAGAGGGGGGATA
CACCGGGCAGCCGAAGCTGGCAAACATCAGCAGTTTCTGCTGGATACATTGCCCAGCTCC
AGGTCAGGGATTGTCCCTGCTGGTATTGGCTGTCTGTAGGCAACTCATTCTTGGCTGATC
GGTTCCGCTCATCGCCTACTTGTCCCGGAAACTCCAGCACCGGTTTCTGGGATCCTGCGG
TGATCAGAACAACCCATCGCGTGTAAAAAAAAAAAAAAATCATCTATGCTATGCTGTTAC
TGCTTGCTACCATTATCTGAACTGCTACTACTAGGTAGCAAGCTTAATCTGGCAAGGTAA
ATAAAGTCTGGAACTTTGAACTGGTTCCAGTGGTGATGATTGTGGTGTGCTTGTATCCTG
ATAACTATTGTGAGTTTGAGACCTGGCTTTGTTGATCTACTGAACTACTACTGTAGCACT
ATGCTTGAAGTTTGTGTGGGCTTGGTTTGCAGTTTGTATTGTTAAAAAAAACTCAAATCT
AGTGATGTATTAAGACCTTGTTTGTGTGTATCTTGTTAATGTGGTATATCTGCAAGAAGG
TATAATCTGTTTGGGAGTG

CDS

936 bp

>Os12t0618600-01 Similar to Transcriptional activator HAP2.
ATGATGAGCTTCAACAAGAGCCAAGAAGGATTTGGGCAGGTTGCTGCTGTGGCCACCCTG
GCCTCCAATGGAGGAGGCTCTCTACCATGGCTGCTGTACGGCGAGCCACTGGGGCAGGGG
AAGCCGGCCATGTCGCCGGAGGGCGTGGTGCCGAGAGCACAGACTCCTCTGGATCCTCCT
CAGGTTCCAGCCATGGACAGGGGTGTCCCTGAAATTCTGAACTTCTCCATGGTTCCAGGT
AAAGGAGAAAAATGTTCTGAGCACTCAACTACTATTGCTCTGCAGTCACCATTTGCAGAA
TATAATGGCTGTTTTGAGCTGGGCCTTGGTCAATCTGTGGTTCCCTCTAATTATCCTTAT
GCTGACCAGCACTATGGCCTACTTTCTCCTTATGGAGTGAGACCAACGCCTAGCGGGCGA
ATTCTTATTCCACCAAATATGCCAGCTGATGCACCAATTTATGTGAATGCAAAACAGTGT
TCAGCCATCATTCGACGTCGCCATGCTCGTGCCAAGGCAGAGAGGGAGAATAGGCTGGTC
AAAGCTAGAAAACCATATCTTCACGAATCACGCCATCTTCATGCAATGCGTCGTGCAAGA
GGCTCTGGTGGGCGCTTCCTCAACACGAAGAAAGAGACCAATGGGAAAACCACTGGTGGA
GGCAGGAAGGTGATGGACATCATCATCCCGCCTCTGTGCCCCGCCGCATCTCCCAGCTCG
GAGCAGTGCAACCCAAGCAGCGTTTCCAGCCTGTCCGGGTCAGAGGTGTCGAGCATATAT
GAACACGAAGACATGGACCACTTCCATAGCTTTGATCATCTCCGGACACACTTCTTCACC
CCGCTCCCGAGCCTCATGGATGTCGAGCACGGGGCTGGTAACCCCTTCAAGTGGACAGCA
GCCTCTGATGGCTGCTGTGACCTCCTCAAAGCATGA

Protein

312 aa

>Os12t0618600-01 Similar to Transcriptional activator HAP2.
MMSFNKSQEGFGQVAAVATLASNGGGSLPWLLYGEPLGQGKPAMSPEGVVPRAQTPLDPP
QVPAMDRGVPEILNFSMVPGKGEKCSEHSTTIALQSPFAEYNGCFELGLGQSVVPSNYPY
ADQHYGLLSPYGVRPTPSGRILIPPNMPADAPIYVNAKQCSAIIRRRHARAKAERENRLV
KARKPYLHESRHLHAMRRARGSGGRFLNTKKETNGKTTGGGRKVMDIIIPPLCPAASPSS
EQCNPSSVSSLSGSEVSSIYEHEDMDHFHSFDHLRTHFFTPLPSLMDVEHGAGNPFKWTA
ASDGCCDLLKA*

5'UTR

chr12:26351183..26351207 (- strand) : 25 bp

chr12:26350441..26350545 (- strand) : 105 bp

CDS

chr12:26350203..26350440 (- strand) : 238 bp

chr12:26348981..26349081 (- strand) : 101 bp

chr12:26348789..26348857 (- strand) : 69 bp

chr12:26348105..26348248 (- strand) : 144 bp

chr12:26347469..26347852 (- strand) : 384 bp

3'UTR

chr12:26346896..26347468 (- strand) : 573 bp

FASTA

>Os12t0618600-01 class=Sequence position=chr12:26346896..26351207 (- strand)
GCTGCTGCTG AAAGCCTGAT GAAATGTGAG TGGGCCTTCT TGTTTCTTTC TTTGCTATAC TCCACACTCC CCCGTGCATG
CCTTGGATCC TTTCGGTTTG GTTTCTTGCT GCTCAGTGGG AGATTCTTGC ATCTGCTGCA CATGCACCTG CTGGCTGTGG
CTGTGGCCTA TGCTTACTAG TAGTAGTAGT AGTAGCTCAC CTTGTTATTG AGAAGTTCTT GGTTTTGTGA CTCCTGTGGG
TTATTGAAGT TCTTGGTTTC AGTTGGGAAG GTGAAAAGAG GATTTCTGGA TTCTTGGGAA GGTTTGATCT TGCATTTATT
CACCCAAGGT TGTTTGTTCA TGTGGTTTGG GGGGTCTTTT TCTTTTTGTT ACTAATAATT TACCCAAGTG TGAGACTTTG
TGGCTCTTTT GATGCATATG TTTGTATGGT GATTGGCCAT GGGTTCTTTG GTAAAGTTGG TTCTTGGTCT GCTTCATCTG
CCTTGTTACT ATCTTCCTTT TGCTAATCTT GTTCTGCTTA GATTGTCTTT TCTCTTGGGG CATCCTTTGC ATTTTGGCTA
ATCTTGTCAT CTCCTTTTGA AGTTTCACCT CTCTTCCTGC ATCTCACTAC CTGATTTGGT GCTTAGTCTA ATCCAATTCC
TTTTTGGTTC TTGTGATTGC AGTGGGTGAT TAGGTGCTTA ACATAATCCC AATCCTAGAA AAATACATTC GGAGTGGTTG
CTGCTGAGCT CAACCAATCA AGCTTGTTGG GGAGGCAAGC AGTCACAATG ATGAGCTTCA ACAAGAGCCA AGAAGGATTT
GGGCAGGTTG CTGCTGTGGC CACCCTGGCC TCCAATGGAG GAGGCTCTCT ACCATGGCTG CTGTACGGCG AGCCACTGGG
GCAGGGGAAG CCGGCCATGT CGCCGGAGGG CGTGGTGCCG AGAGCACAGA CTCCTCTGGA TCCTCCTCAG GTTCCAGCCA
TGGACAGGGG TGTCCCTGAA ATTCTGAACT TCTCCATGGT TCCAGGTGAG GCTGCCTGTT CTTGGTTTCA TGGTTTGTGA
GTGAAATGGA CTTGGTTGAT GTATCTGTGG ATGGTAACAG CAAAGAGTTA GGGAATTATG TGCAACATAT GTGAGTGACA
TAGGGTTGGA TTCAGGTTGC AAAAAAAAGA AAAAAAAACT AAATATCTAA AATATCTAGT TTTGGTATAA AGTTGGCACT
GATTTGCTGT TATTTCTTTG TTGCTTAAAT GTGAAAATGG ATTTGATTGA TGTCTCTGTG AATGTTATAG CAAAAAGTAA
GTACTAGGCA ATTATATGCA ACATATGTGA GTGACATAGG GTTGGATTCA GGTTGCAAAA GTCTAGTTTT GGTATAAAGT
TGCCACTGGT TTGCAGTTAT TTCTTTGTTG CTTGAATGTG AAAAGGTTTG ATTTTTGGAT GAGAGGTTAA TCCCTGAGCC
AAGGGTGTGT ATCTCTGTAA GCACAACTAG TAGGCTTATT GCCATGTTAT CATTAGATGG TTTTTTCGGT TGCAAAAGTC
TATATAGATA TGCAAGTCCA AAAGTAATAT TAGCAGAAAA TAATTAATAT TACAGATGAA AGTATTGCCA TGTTATCATT
AGATGGTTTT TTCGGTTTTC ACGGAAAGGC TGCTCGCATG TACTTAGGCA AATCGTGAAA GTACTACAGT AGGGATTAAT
ACTGTGTAAC AGTCATATAT TTGGTTTAGG TTAGAAACTG TTGATGATTT GGTTTTGCAG TAAAAAAAAG ATAGTGTCAA
GCAACATGTG CCAGAGAAAT GCTGATACTT CTGGGTTACA AAATTTTTTT CTTTGATACA AGGTGACATG ACACCAAAGC
AACTTCAACC CTTCTACATT AATTATTTAC CGCACAATCT AGTATGGCTA ATTTGGTCCC TCTGAAACTT ATAATACATC
ATAGCCTGAT AGGTCAAGAT GGCATGAGTA CAAGGACCCA CAAATGTTTA AATTCTTCTT TTGACATTGG TTACCACATA
ATTGTGTTGG TTAGACTAGA CAAGAACCTT GAATCATGCA TGAACAATCT TTTGTTTCTG ATAATAAGAG TACAGACCGT
CATTGACTGC TTCTGTTTTA TGATTGGACA TCTAATTGCT TTTCAGGTAA AGGAGAAAAA TGTTCTGAGC ACTCAACTAC
TATTGCTCTG CAGTCACCAT TTGCAGAATA TAATGGCTGT TTTGAGCTGG GCCTTGGTCA ATCTGTGGTA AGCTTTCCCC
TCTATTTGTT TATGTTGACG CATTGAATAA AGATCATCGA CCTTACAGAT GAACATGCCC ATTTCCGAAT TTCCCTAGTG
CTGAGTTGAG AAATGGCTTC AATGTTTCAG GTTCCCTCTA ATTATCCTTA TGCTGACCAG CACTATGGCC TACTTTCTCC
TTATGGAGTG AGACCAACGG TATGTTTCTG TTGATCTCTG AGGAGTCATC TTGAGATTTT CTCTGACTCT GAAGAAAACA
CAGCTAACTG TAGCAACACT ATCACCAAAC TAACACATAT ATAGAGCACT TTGATCAATT GTGCCCTTGA ATTCCACAGT
TTGAACAGTC TTGTGCAACA ATTCTTTTGT TTGCTGCAAA TTGGTTTACT GTTTTTGTAT GTGTTGGGAT TTGTGAACAT
TGATTAAGCT CACCAGTGCT TTAATCAATC CAATAAATAA AGAAAAAAAT GCTTTAGCAT CTTATTCACC AGTGCAGAAA
GAACGGGTAA ATAATAGGCA GGTATGGCTA AAGCTTTGGT AATAATAGCA GGCGCAGTTT CATGATGTTT GGACATACTT
GCTGTTGCGA TTTTTTTCTC CCTCTTGGTA GTCCAGCAAA GATGTAAAAC GGACTGTTTT TTGTTTCAAG CTGTAGTTTT
TCAACTGGCA TAATCTATTG AAAGCTCTAA ATTATGCACG CTAACTAATA TGTTCCTCTA TTTTCTTTGT GGAATGCAGC
CTAGCGGGCG AATTCTTATT CCACCAAATA TGCCAGCTGA TGCACCAATT TATGTGAATG CAAAACAGTG TTCAGCCATC
ATTCGACGTC GCCATGCTCG TGCCAAGGCA GAGAGGGAGA ATAGGCTGGT CAAAGCTAGA AAAGTAAGTC TCAACTTTCA
ACTGTCGATG GATTCTTTCA GTTTTGCAAT TTTGTACATA TCTTTGTAAG AACTTATCCT TCTTTTTAAA AATTACCATT
GGGGTTTCCC ATACTGTATT GGGCAAAAAA AGGAAAAGGA AAGAACTATC AATGAATCCA AAACTGTTGC CTAAGTGAGA
TGTTTTGATT CCATTTCCAC TTTATCTCGC AGAATTTCTT CTCTTCTGCA TTCATGTGAG TTCTCTTTGA TGCAGCCATA
TCTTCACGAA TCACGCCATC TTCATGCAAT GCGTCGTGCA AGAGGCTCTG GTGGGCGCTT CCTCAACACG AAGAAAGAGA
CCAATGGGAA AACCACTGGT GGAGGCAGGA AGGTGATGGA CATCATCATC CCGCCTCTGT GCCCCGCCGC ATCTCCCAGC
TCGGAGCAGT GCAACCCAAG CAGCGTTTCC AGCCTGTCCG GGTCAGAGGT GTCGAGCATA TATGAACACG AAGACATGGA
CCACTTCCAT AGCTTTGATC ATCTCCGGAC ACACTTCTTC ACCCCGCTCC CGAGCCTCAT GGATGTCGAG CACGGGGCTG
GTAACCCCTT CAAGTGGACA GCAGCCTCTG ATGGCTGCTG TGACCTCCTC AAAGCATGAC TAGAGGGGGG ATACACCGGG
CAGCCGAAGC TGGCAAACAT CAGCAGTTTC TGCTGGATAC ATTGCCCAGC TCCAGGTCAG GGATTGTCCC TGCTGGTATT
GGCTGTCTGT AGGCAACTCA TTCTTGGCTG ATCGGTTCCG CTCATCGCCT ACTTGTCCCG GAAACTCCAG CACCGGTTTC
TGGGATCCTG CGGTGATCAG AACAACCCAT CGCGTGTAAA AAAAAAAAAA AATCATCTAT GCTATGCTGT TACTGCTTGC
TACCATTATC TGAACTGCTA CTACTAGGTA GCAAGCTTAA TCTGGCAAGG TAAATAAAGT CTGGAACTTT GAACTGGTTC
CAGTGGTGAT GATTGTGGTG TGCTTGTATC CTGATAACTA TTGTGAGTTT GAGACCTGGC TTTGTTGATC TACTGAACTA
CTACTGTAGC ACTATGCTTG AAGTTTGTGT GGGCTTGGTT TGCAGTTTGT ATTGTTAAAA AAAACTCAAA TCTAGTGATG
TATTAAGACC TTGTTTGTGT GTATCTTGTT AATGTGGTAT ATCTGCAAGA AGGTATAATC TGTTTGGGAG TG

Locus: Os12g0618600

Loading...

Locus: Os12g0618600

Loading...