Os12t0619100-00

Locus

Os12g0619100

Description

Heat shock protein DnaJ, cysteine-rich domain domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjA12

Oryzabase Gene Name Synonym(s)

DnaJ domain protein A12

Transcript Evidence

AK360735 (DDBJ)

Protein Evidence

Q2QM34 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: heat shock protein binding (GO:0031072)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Heat shock protein DnaJ, cysteine-rich domain (IPR001305)

Heat shock protein DnaJ, N-terminal (IPR001623)

Chaperone DnaJ, C-terminal (IPR002939)

Heat shock protein DnaJ (IPR003095)

HSP40/DnaJ peptide-binding (IPR008971)

Heat shock protein DnaJ, conserved site (IPR018253)

Expression Databases

TENOR (Os12t0619100-00)

Others

Oryzabase (12149)

Transcript

1355 bp

>Os12t0619100-00 Heat shock protein DnaJ, cysteine-rich domain domain containing protein.
CCGTCGTCTTCTCGCCGGAATTCGTAAGCCGCCGCCGTTGATCGACGACGGCGACGACGA
CGATGGCGGCGCCAGGGTGCAACAGCGACAACAGCCGGTACTACGACCTCCTCGGCGTGC
CGCGCGGCGCCGACGGCGACGAGATCAGGCGCGCGTACCGGCGCGCCGCCGTGACGCACC
ACCCGGACAAGGGCGGCGACGAGGAGGCGTTCAAGGAGGTGGCCCGCGCGTACCAGGTGC
TCGGCGACCCCGCCCTGCGCGAGGTCTACGACGTCTACGGCGAGGACGGCGTCAATGGCG
GGGTCGGCGCCGCCGCCGCCGGCTTCGGCCGGTACGACGACGCGTTTGACGAGTTCGTCG
AGACGTTCAGGTACCTCGTCGCCGCCGGCGGCGCCGACAGGGCGTTCGGCGACGCCGTCG
AGATGCTCAGGCACTTGTTCGTTGACTTGTCCCTCGAGGAGTTCTACAATGGCGCCACCA
AGAAGTTCACGCTCTCGCGCGACGTCACCTGCATCCCCTGCAAAGGGACGGGGAGTACGC
TCGCCTCGCCGGCGACGTGCGCGGCGTGCAGCGGCGCCGGCTACAAGGTGGTCTCCCAGC
TGATGCGACTCCGGCGACGCGGGAGCGAGCCCTGCGCGGCGTGCGGCGGCAGAGGCGAGG
TCTCACGGGGCCTGAAGCGCTGCTCCGCGTGCCGCGGCAGCAAGGTGGCGACGGACACCA
AGGTCCTGGAGCTCGCCGTCGAGAAGGGCGTGCCGGACGGCCACCGGATCACCTTCCCCG
GCGAGGCCGACGTCAAGGAGAACGGCGTCGCCGGCGACCTGGTGATGGGGCTCCGGCAGA
AGAAGCACGGCAAGTTCACGAGGAAAGGCGACGACCTCGTCTACGAGCACGAGCTGTCGC
TGGCAGAGGCGCTGTGCGGGTTCCAGTTCGTGATCACCCACCTCGACGGCCGGCGGCTGC
TGGTCACCTCCGGCGCCGGCGAGGTGATCAGGCCGGGCCAGCTCAAGGCCATCGACGGCG
AGGGCATGCCAGTGCACGGCATGCCGTTCGCCAAGGGCACGCTCTACGTCGCCTTCCGCG
TCGCGTTCCCGGGCACGATGACCCCGGCGCTCCGCGACGCCGTCGGCTCCGCGTTCCCCG
CGGCCACGAAGGCGGCGGCCGTGGAGGACGGCGGCGGGTGCGAGGAGACGACGACGACGA
CGCGGGACGTCGGAGGGGAAGAGGAGATGAAGCTCAACGCGAAGGGCGAGCAGTCGCCGA
CGACGCGGATGGAGCACGGCGCCGGCGGCGAGGATGAATACGTGCACGTGCACGGGCACG
TCGACGAGGAGGAGGAGGATAATGAGGAGATGTAA

CDS

1293 bp

>Os12t0619100-00 Heat shock protein DnaJ, cysteine-rich domain domain containing protein.
ATGGCGGCGCCAGGGTGCAACAGCGACAACAGCCGGTACTACGACCTCCTCGGCGTGCCG
CGCGGCGCCGACGGCGACGAGATCAGGCGCGCGTACCGGCGCGCCGCCGTGACGCACCAC
CCGGACAAGGGCGGCGACGAGGAGGCGTTCAAGGAGGTGGCCCGCGCGTACCAGGTGCTC
GGCGACCCCGCCCTGCGCGAGGTCTACGACGTCTACGGCGAGGACGGCGTCAATGGCGGG
GTCGGCGCCGCCGCCGCCGGCTTCGGCCGGTACGACGACGCGTTTGACGAGTTCGTCGAG
ACGTTCAGGTACCTCGTCGCCGCCGGCGGCGCCGACAGGGCGTTCGGCGACGCCGTCGAG
ATGCTCAGGCACTTGTTCGTTGACTTGTCCCTCGAGGAGTTCTACAATGGCGCCACCAAG
AAGTTCACGCTCTCGCGCGACGTCACCTGCATCCCCTGCAAAGGGACGGGGAGTACGCTC
GCCTCGCCGGCGACGTGCGCGGCGTGCAGCGGCGCCGGCTACAAGGTGGTCTCCCAGCTG
ATGCGACTCCGGCGACGCGGGAGCGAGCCCTGCGCGGCGTGCGGCGGCAGAGGCGAGGTC
TCACGGGGCCTGAAGCGCTGCTCCGCGTGCCGCGGCAGCAAGGTGGCGACGGACACCAAG
GTCCTGGAGCTCGCCGTCGAGAAGGGCGTGCCGGACGGCCACCGGATCACCTTCCCCGGC
GAGGCCGACGTCAAGGAGAACGGCGTCGCCGGCGACCTGGTGATGGGGCTCCGGCAGAAG
AAGCACGGCAAGTTCACGAGGAAAGGCGACGACCTCGTCTACGAGCACGAGCTGTCGCTG
GCAGAGGCGCTGTGCGGGTTCCAGTTCGTGATCACCCACCTCGACGGCCGGCGGCTGCTG
GTCACCTCCGGCGCCGGCGAGGTGATCAGGCCGGGCCAGCTCAAGGCCATCGACGGCGAG
GGCATGCCAGTGCACGGCATGCCGTTCGCCAAGGGCACGCTCTACGTCGCCTTCCGCGTC
GCGTTCCCGGGCACGATGACCCCGGCGCTCCGCGACGCCGTCGGCTCCGCGTTCCCCGCG
GCCACGAAGGCGGCGGCCGTGGAGGACGGCGGCGGGTGCGAGGAGACGACGACGACGACG
CGGGACGTCGGAGGGGAAGAGGAGATGAAGCTCAACGCGAAGGGCGAGCAGTCGCCGACG
ACGCGGATGGAGCACGGCGCCGGCGGCGAGGATGAATACGTGCACGTGCACGGGCACGTC
GACGAGGAGGAGGAGGATAATGAGGAGATGTAA

Protein

431 aa

>Os12t0619100-00 Heat shock protein DnaJ, cysteine-rich domain domain containing protein.
MAAPGCNSDNSRYYDLLGVPRGADGDEIRRAYRRAAVTHHPDKGGDEEAFKEVARAYQVL
GDPALREVYDVYGEDGVNGGVGAAAAGFGRYDDAFDEFVETFRYLVAAGGADRAFGDAVE
MLRHLFVDLSLEEFYNGATKKFTLSRDVTCIPCKGTGSTLASPATCAACSGAGYKVVSQL
MRLRRRGSEPCAACGGRGEVSRGLKRCSACRGSKVATDTKVLELAVEKGVPDGHRITFPG
EADVKENGVAGDLVMGLRQKKHGKFTRKGDDLVYEHELSLAEALCGFQFVITHLDGRRLL
VTSGAGEVIRPGQLKAIDGEGMPVHGMPFAKGTLYVAFRVAFPGTMTPALRDAVGSAFPA
ATKAAAVEDGGGCEETTTTTRDVGGEEEMKLNAKGEQSPTTRMEHGAGGEDEYVHVHGHV
DEEEEDNEEM*

5'UTR

chr12:26377806..26377867 (+ strand) : 62 bp

CDS

chr12:26377868..26378242 (+ strand) : 375 bp

chr12:26378354..26378442 (+ strand) : 89 bp

chr12:26378935..26379205 (+ strand) : 271 bp

chr12:26379292..26379849 (+ strand) : 558 bp

FASTA

>Os12t0619100-00 class=Sequence position=chr12:26377806..26379849 (+ strand)
CCGTCGTCTT CTCGCCGGAA TTCGTAAGCC GCCGCCGTTG ATCGACGACG GCGACGACGA CGATGGCGGC GCCAGGGTGC
AACAGCGACA ACAGCCGGTA CTACGACCTC CTCGGCGTGC CGCGCGGCGC CGACGGCGAC GAGATCAGGC GCGCGTACCG
GCGCGCCGCC GTGACGCACC ACCCGGACAA GGGCGGCGAC GAGGAGGCGT TCAAGGAGGT GGCCCGCGCG TACCAGGTGC
TCGGCGACCC CGCCCTGCGC GAGGTCTACG ACGTCTACGG CGAGGACGGC GTCAATGGCG GGGTCGGCGC CGCCGCCGCC
GGCTTCGGCC GGTACGACGA CGCGTTTGAC GAGTTCGTCG AGACGTTCAG GTACCTCGTC GCCGCCGGCG GCGCCGACAG
GGCGTTCGGC GACGCCGTCG AGATGCTCAG GCACTTGGTG GCCGGTGTCG CCGCCGGCGG TGGCGCCGAC GACGGCGGCA
AGGCGTTCGA CGAGGTGATC GTTGGGATGT TCAAGAACAT GATGTCCGGC GGCGACAGCA GCGTGGAGTT CGTTGACTTG
TCCCTCGAGG AGTTCTACAA TGGCGCCACC AAGAAGTTCA CGCTCTCGCG CGACGTCACC TGCATCCCCT GCAAAGGGTA
ATGTGACGTC ATCCAAACCT TGCCGCGGAT CATGTCaaac tgttttaaac actcgagtgg aagttcaccc gttttttttc
atatcatccg aatggttata attttttttt aaaaaaataa caatgataga ttaatatgta atatatcact tcataaacat
gcaagttaat attcgacttc tataatttgt aaaaaaaaca ataaatttga ctgcgaatat acatatacta gttaaagttt
aatttgttat ttttgttaca atttgtagga gtcgaatttg aatttgcatg tttgtgaatt ttttttaaag attaatatta
catactaatc tatatagtaa ttttttttaa atttttttat aattatttag ttgacatgta agaaacgggt ggacatcgaa
ctgagagatt agaatccatc TACCACGCTT CGTCGTCTTC GCCGTGTCGC TAATCTAACG TGTTTGTTGT TTCGCTTGGT
CCCGAGCAGG ACGGGGAGTA CGCTCGCCTC GCCGGCGACG TGCGCGGCGT GCAGCGGCGC CGGCTACAAG GTGGTCTCCC
AGCTGATGCG ACTCCGGCGA CGCGGGAGCG AGCCCTGCGC GGCGTGCGGC GGCAGAGGCG AGGTCTCACG GGGCCTGAAG
CGCTGCTCCG CGTGCCGCGG CAGCAAGGTG GCGACGGACA CCAAGGTCCT GGAGCTCGCC GTCGAGAAGG GCGTGCCGGA
CGGCCACCGG ATCACCTTCC CCGGCGAGGC CGACGTCAAG GTACGTACAC CACCCACCTC GGATTTGACC GAACACCTTG
AGCTCATCTG AATCGATGCG TCATCGTGAC ACGTTGTGCC GTGCAGGAGA ACGGCGTCGC CGGCGACCTG GTGATGGGGC
TCCGGCAGAA GAAGCACGGC AAGTTCACGA GGAAAGGCGA CGACCTCGTC TACGAGCACG AGCTGTCGCT GGCAGAGGCG
CTGTGCGGGT TCCAGTTCGT GATCACCCAC CTCGACGGCC GGCGGCTGCT GGTCACCTCC GGCGCCGGCG AGGTGATCAG
GCCGGGCCAG CTCAAGGCCA TCGACGGCGA GGGCATGCCA GTGCACGGCA TGCCGTTCGC CAAGGGCACG CTCTACGTCG
CCTTCCGCGT CGCGTTCCCG GGCACGATGA CCCCGGCGCT CCGCGACGCC GTCGGCTCCG CGTTCCCCGC GGCCACGAAG
GCGGCGGCCG TGGAGGACGG CGGCGGGTGC GAGGAGACGA CGACGACGAC GCGGGACGTC GGAGGGGAAG AGGAGATGAA
GCTCAACGCG AAGGGCGAGC AGTCGCCGAC GACGCGGATG GAGCACGGCG CCGGCGGCGA GGATGAATAC GTGCACGTGC
ACGGGCACGT CGACGAGGAG GAGGAGGATA ATGAGGAGAT GTAA

Locus: Os12g0619100

Loading...

Locus: Os12g0619100

Loading...