Os12t0626400-01

Locus

Os12g0626400

Description

Similar to Phytoene synthase 1, chloroplast precursor (EC 2.5.1.-) (Fruit ripening specific protein pTOM5).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PSY2

CGSNL Gene Name

PHYTOENE SYNTHASE 2

Oryzabase Gene Symbol Synonym(s)

PSY2, OsPSY2

Oryzabase Gene Name Synonym(s)

phytoene synthase 2

Transcript Evidence

AK063967 (DDBJ, Best hit)

Protein Evidence

Q8W014 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: biosynthetic process (GO:0009058)

Molecular Function: transferase activity (GO:0016740)

Molecular Function: transferase activity, transferring alkyl or aryl (other than methyl) groups (GO:0016765)

Functional domain (InterPro)

Squalene/phytoene synthase (IPR002060)

Terpenoid synthase (IPR008949)

Squalene/phytoene synthase, conserved site (IPR019845)

Full-length cDNA

001-124-A11 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0626400-01)

RiceXPro (AK063967)

Others

Oryzabase (8087)

KEGG (Os12t0626400-01 (EC:2.5.1.32))

Transcript

1333 bp

>Os12t0626400-01 Similar to Phytoene synthase 1, chloroplast precursor (EC 2.5.1.-) (Fruit ripening specific protein pTOM5).
ACAACCCCAACCATTCGACCCGCGCAGCGAGCCCCAACCCCACATCGCCGCGCGCCCCCG
ATGGCGTCCTCCTCGTCGGCGGCGGCGCTCTGGACGGCGGCGCCCCACCCCCACGGCAGC
TGCATCAGGATCCACGCCATCTTCCACCAGCGTCACCAGCGGAGGGGGAGGAGGCCGGTC
GTCGTCGCCTCGTCGGTGAGGCCGCTGCAGGCCGCGAGCCTGGCGGTGGCCACGGCGCCG
GTGGCCGTGGCGTCGAGGAGGACGGCGGCGGAGGAGGCCGTCTACGAGGTACTCAGCTTA
TGACTCCTGAAAGGCGCAAAGCTGTCTGGGCAATCTATGTATGGTGCAGAAGAACTGATG
AACTGGTAGATGGCCCTAACTCGTCTTACATTACACCAAAGGCACTTGATCGATGGGAGA
AGAGATTAGAAGATCTCTTCGAAGGCAGGCCATATGATATGTATGATGCAGCCCTCTCGG
ACACAGTGTCAAAGTTTCCAGTAGATATCCAGCCATTCAAAGACATGATTGAAGGAATGA
GGCTTGACCTGTGGAAATCAAGGTATAGGAGCTTTGATGAGCTCTACCTCTACTGCTACT
ACGTTGCTGGCACGGTTGGTCTCATGACAGTACCGGTGATGGGGATTGCCCCCGACTCGA
AGGCCTCAACCGAGAGCGTGTACAACGCTGCGCTAGCTCTTGGGATCGCCAACCAGCTGA
CGAATATTCTCAGAGACGTAGGCGAAGACTCAAGGAGGGGAAGAATCTACCTTCCATTGG
ATGAATTGGCAGAGGCAGGTCTGACAGAAGAAGACATATTCAGAGGGAAAGTGACTGATA
AATGGAGGAAGTTCATGAAGGGACAAATTCTGCGTGCCAGGTTATTCTTTGATGAGGCGG
AGAAGGGCGTTGCGCATCTAGACTCTGCGAGTAGATGGCCGGTTCTGGCATCTTTGTGGT
TATACCGGCAGATCCTTGATGCTATCGAAGCAAACGACTACAACAACTTCACCAAGCGCG
CGTATGTAAACAAGGCAAAGAAGCTGCTGTCTTTACCGGTCGCTTATGCAAGAGCGGCAG
TTGCATCATGAACAATCACTAGATCAGATGCCTTATTATTTTTTTTCTTTCATTTTCTTT
TCTTTTGATTTCGCACGATTTCTTGGCTGTTGTATATATTCAAGCAGCTACCTGTATGCC
ATAAGCCTGCCACAGTTTTTCTTTAGTTCAAGGGACTGATTTCAGGTCCCTCAATACTCA
ACTCTTGTTAGAAACAAATACAGAGGGGGTAAGCCCCACAGTTCAAGAAGCATATTACTC
TTCATTTGTCTTC

CDS

1089 bp

>Os12t0626400-01 Similar to Phytoene synthase 1, chloroplast precursor (EC 2.5.1.-) (Fruit ripening specific protein pTOM5).
AACCCCAACCATTCGACCCGCGCAGCGAGCCCCAACCCCACATCGCCGCGCGCCCCCGAT
GGCGTCCTCCTCGTCGGCGGCGGCGCTCTGGACGGCGGCGCCCCACCCCCACGGCAGCTG
CATCAGGATCCACGCCATCTTCCACCAGCGTCACCAGCGGAGGGGGAGGAGGCCGGTCGT
CGTCGCCTCGTCGGTGAGGCCGCTGCAGGCCGCGAGCCTGGCGGTGGCCACGGCGCCGGT
GGCCGTGGCGTCGAGGAGGACGGCGGCGGAGGAGGCCGTCTACGAGGTACTCAGCTTATG
ACTCCTGAAAGGCGCAAAGCTGTCTGGGCAATCTATGTATGGTGCAGAAGAACTGATGAA
CTGGTAGATGGCCCTAACTCGTCTTACATTACACCAAAGGCACTTGATCGATGGGAGAAG
AGATTAGAAGATCTCTTCGAAGGCAGGCCATATGATATGTATGATGCAGCCCTCTCGGAC
ACAGTGTCAAAGTTTCCAGTAGATATCCAGCCATTCAAAGACATGATTGAAGGAATGAGG
CTTGACCTGTGGAAATCAAGGTATAGGAGCTTTGATGAGCTCTACCTCTACTGCTACTAC
GTTGCTGGCACGGTTGGTCTCATGACAGTACCGGTGATGGGGATTGCCCCCGACTCGAAG
GCCTCAACCGAGAGCGTGTACAACGCTGCGCTAGCTCTTGGGATCGCCAACCAGCTGACG
AATATTCTCAGAGACGTAGGCGAAGACTCAAGGAGGGGAAGAATCTACCTTCCATTGGAT
GAATTGGCAGAGGCAGGTCTGACAGAAGAAGACATATTCAGAGGGAAAGTGACTGATAAA
TGGAGGAAGTTCATGAAGGGACAAATTCTGCGTGCCAGGTTATTCTTTGATGAGGCGGAG
AAGGGCGTTGCGCATCTAGACTCTGCGAGTAGATGGCCGGTTCTGGCATCTTTGTGGTTA
TACCGGCAGATCCTTGATGCTATCGAAGCAAACGACTACAACAACTTCACCAAGCGCGCG
TATGTAAACAAGGCAAAGAAGCTGCTGTCTTTACCGGTCGCTTATGCAAGAGCGGCAGTT
GCATCATGA

Protein

363 aa

>Os12t0626400-01 Similar to Phytoene synthase 1, chloroplast precursor (EC 2.5.1.-) (Fruit ripening specific protein pTOM5).
NPNHSTRAASPNPTSPRAPDGVLLVGGGALDGGAPPPRQLHQDPRHLPPASPAEGEEAGR
RRLVGEAAAGREPGGGHGAGGRGVEEDGGGGGRLRGTQLMTPERRKAVWAIYVWCRRTDE
LVDGPNSSYITPKALDRWEKRLEDLFEGRPYDMYDAALSDTVSKFPVDIQPFKDMIEGMR
LDLWKSRYRSFDELYLYCYYVAGTVGLMTVPVMGIAPDSKASTESVYNAALALGIANQLT
NILRDVGEDSRRGRIYLPLDELAEAGLTEEDIFRGKVTDKWRKFMKGQILRARLFFDEAE
KGVAHLDSASRWPVLASLWLYRQILDAIEANDYNNFTKRAYVNKAKKLLSLPVAYARAAV
AS*

5'UTR

chr12:26783583..26783584 (- strand) : 2 bp

CDS

chr12:26783297..26783582 (- strand) : 286 bp

chr12:26782096..26782146 (- strand) : 51 bp

chr12:26781808..26781980 (- strand) : 173 bp

chr12:26781443..26781678 (- strand) : 236 bp

chr12:26780971..26781163 (- strand) : 193 bp

chr12:26780734..26780883 (- strand) : 150 bp

3'UTR

chr12:26780492..26780733 (- strand) : 242 bp

FASTA

>Os12t0626400-01 class=Sequence position=chr12:26780492..26783584 (- strand)
ACAACCCCAA CCATTCGACC CGCGCAGCGA GCCCCAACCC CACATCGCCG CGCGCCCCCG ATGGCGTCCT CCTCGTCGGC
GGCGGCGCTC TGGACGGCGG CGCCCCACCC CCACGGCAGC TGCATCAGGA TCCACGCCAT CTTCCACCAG CGTCACCAGC
GGAGGGGGAG GAGGCCGGTC GTCGTCGCCT CGTCGGTGAG GCCGCTGCAG GCCGCGAGCC TGGCGGTGGC CACGGCGCCG
GTGGCCGTGG CGTCGAGGAG GACGGCGGCG GAGGAGGCCG TCTACGAGGT CGTGCTGCGG CAGGCGGCGC TGGTGGAGGA
GGCCACCCAC CGCCGCGGCG CGGGGGCGCC GCGGTGGGCG GAGGAGGACG CCGTCGACTG GGGCCTCCTC CTCGGCGACG
CCTACCACCG CTGCGGCGAG GTCTGCGCCG AGTACGCCAA GACCTTCTAC CTAGGTCAGC CAACCCAACA TTGACTAATC
ATTCAATTTT GTTTTTGTCA CCGTTATTAC TTTATCATTT CACAGGTGAA AGCTAGCTAC TATTCGTTTG CCACTACTAC
TCCCTAGCTT AGCTAGCGTC TCTTCCTTTT CTTGATTTGT TCATAGTACT GTATATGATA ATTGTAGACC TACCCTTTCT
CTATTTCTTT TTGGGTTCTT GGGTGGAATG GCTGGCTTGA TAAAATTTTG CGACCCTTTT TGTGGTTCTA GGAGCCACAT
CTCACTTTCA CTTTCTTGTA CTTGTTGGTC TAAAAAGATT AGTTAATGCT GCAATTAGTT GGCTTTTACT AGGAATTGTA
AGAGGGTGGT GTTAAAAGGT GATTAAAAAA AAATCTATGA ACATTCCTAG ATTCCTATTA CGTGTTAAGA AGATAAATAT
TCCTGCGTAT AATTTATGGA ATACTCCTTC TGATGGCAAA AATATATTAG CAGTAGCCAA ACAACACCAG CCTGAGTGAG
TGAGTGGCTC TCAGTGCTCT GAACAACTGT ACATGTATAT ACAAATGTTT GCCGACTTCA GAGTAGGTAA GATAATGCAC
TTGGATGATA GATGCCATCC CAAGGAAATG ATCCAACAAG CAGATGCGCA GATATGGTGA TCTCTCTAGT GCACCACTGG
CAATTTATAG ATTTCTCTTC TTAATTAGGG TCAGGGATAT GCTGGTTGGT GGTGGGTTTG TGGGTGATGT GAGGACGCAT
GGGCTTGATT GATGAATCCA GTAACCTTCT TGTTTTTTTT AATCTTGCTT TCTGTATCAC CGTGTTTCCA CTTGGATCAT
CCCTGACCTG GTAAGGGACT CATTTTCTAT TGCTATGAGG ACCTTTTGGG GACTAGCTCA AACTCTGATG TATGGTTGAT
ACTTAGATTT TCTACGTAAA GTGGAATTTC ACCTTGTGTA ATTTCTCATG GTTTTTGTTT CCATCGTTTA CATTTCAGGT
ACTCAGCTTA TGACTCCTGA AAGGCGCAAA GCTGTCTGGG CAATCTATGG TATGGATTAG TTAACTATTC ATTGATCTAC
CAGTTACTCT CACTTGTGAA AATTCAGATA ACTTCAATTG TTTGTGGAAT TTTTAATTCT TACCTTTGTT TTTGTCTTTG
GCAGTATGGT GCAGAAGAAC TGATGAACTG GTAGATGGCC CTAACTCGTC TTACATTACA CCAAAGGCAC TTGATCGATG
GGAGAAGAGA TTAGAAGATC TCTTCGAAGG CAGGCCATAT GATATGTATG ATGCAGCCCT CTCGGACACA GTGTCAAAGT
TTCCAGTAGA TATCCAGGTA CAGCCAACAA AAAAGCTACT GTAAAAGCAG GATATGAAGT GCTTTTAAAA GTTATTAGTA
CACAGTAAAT TGGTGACACG CATTTGTCTG ATGTTTCTGC ACCGTCGGGA TCTCTTTTAT TTACAGCCAT TCAAAGACAT
GATTGAAGGA ATGAGGCTTG ACCTGTGGAA ATCAAGGTAT AGGAGCTTTG ATGAGCTCTA CCTCTACTGC TACTACGTTG
CTGGCACGGT TGGTCTCATG ACAGTACCGG TGATGGGGAT TGCCCCCGAC TCGAAGGCCT CAACCGAGAG CGTGTACAAC
GCTGCGCTAG CTCTTGGGAT CGCCAACCAG CTGACGAATA TTCTCAGAGA CGTAGGCGAA GAGTAAGTAC CAATGTGCTC
ACTACCAGCA TGTTCTTTTT CTGAGTTAAT AATTGCAGAC TTTCACATGA TAAATATGTA GTTTGACACC CAATATGTAT
TGCACAAACC ATTTGCGCTT TAAAGTCTAG TCCAAAATTG TGCCTAAACA GATGCCTTTC ACATTAAAAA TTTGAAGCGC
ACATAAGTTT AATTTAAGGC ATATGTACCG ATTTGTCGCT ATTGAGATTA AGTTTTTTGG TTGATTGTGA TGTAATATGT
TTGTTGTGGA TGGAATTTCA GCTCAAGGAG GGGAAGAATC TACCTTCCAT TGGATGAATT GGCAGAGGCA GGTCTGACAG
AAGAAGACAT ATTCAGAGGG AAAGTGACTG ATAAATGGAG GAAGTTCATG AAGGGACAAA TTCTGCGTGC CAGGTTATTC
TTTGATGAGG CGGAGAAGGG CGTTGCGCAT CTAGACTCTG CGAGTAGATG GCCGGTATGA GAGGCTACAA ATTCTGCGGT
TTTATGTTCC ACAAATAAAA TAAACCACTG AAATTTACCT TAATCGATTA TTTTCTCGTA GGTTCTGGCA TCTTTGTGGT
TATACCGGCA GATCCTTGAT GCTATCGAAG CAAACGACTA CAACAACTTC ACCAAGCGCG CGTATGTAAA CAAGGCAAAG
AAGCTGCTGT CTTTACCGGT CGCTTATGCA AGAGCGGCAG TTGCATCATG AACAATCACT AGATCAGATG CCTTATTATT
TTTTTTCTTT CATTTTCTTT TCTTTTGATT TCGCACGATT TCTTGGCTGT TGTATATATT CAAGCAGCTA CCTGTATGCC
ATAAGCCTGC CACAGTTTTT CTTTAGTTCA AGGGACTGAT TTCAGGTCCC TCAATACTCA ACTCTTGTTA GAAACAAATA
CAGAGGGGGT AAGCCCCACA GTTCAAGAAG CATATTACTC TTCATTTGTC TTC

Locus: Os12g0626400

Loading...

Locus: Os12g0626400

Loading...