Os12t0626400-02

Locus

Os12g0626400

Description

Phytoene synthase 2, Carotenoid biosynthesis

RAP-DB Gene Symbol Synonym(s)

OsPSY2

RAP-DB Gene Name Synonym(s)

phytoene synthase 2

CGSNL Gene Symbol

PSY2

CGSNL Gene Name

PHYTOENE SYNTHASE 2

Oryzabase Gene Symbol Synonym(s)

PSY2, OsPSY2

Oryzabase Gene Name Synonym(s)

phytoene synthase 2

Transcript Evidence

AK073290

Protein Evidence

Q2QLV9

Literature

PMID: 18326788

PMID: 15247400

Note

Manual Curation

February 1, 2021

Gene Ontology (GO)

Biological Process: ergosterol biosynthetic process (GO:0006696)

Molecular Function: farnesyl-diphosphate farnesyltransferase activity (GO:0004310)

Molecular Function: transferase activity, transferring alkyl or aryl (other than methyl) groups (GO:0016765)

Molecular Function: squalene synthase activity (GO:0051996)

Functional domain (InterPro)

Isoprenoid synthase domain superfamily (IPR008949)

Trans-Isoprenyl Diphosphate Synthases, head-to-head (IPR033904)

Squalene/phytoene synthase, conserved site (IPR019845)

Full-length cDNA

J033025L21 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0626400-02)

RiceXPro (AK073290)

Others

Oryzabase (8087)

Transcript

1482 bp

>Os12t0626400-02 Phytoene synthase 2, Carotenoid biosynthesis
CCCAACCATTCGACCCGCGCAGCGAGCCCCAACCCCACATCGCCGCGCGCCCCCGATGGC
GTCCTCCTCGTCGGCGGCGGCGCTCTGGACGGCGGCGCCCCACCCCCACGGCAGCTGCAT
CAGGATCCACGCCATCTTCCACCAGCGTCACCAGCGGAGGGGGAGGAGGCCGGTCGTCGT
CGCCTCGTCGGTGAGGCCGCTGCAGGCCGCGAGCCTGGCGGTGGCCACGGCGCCGGTGGC
CGTGGCGTCGAGGAGGACGGCGGCGGAGGAGGCCGTCTACGAGGTCGTGCTGCGGCAGGC
GGCGCTGGTGGAGGAGGCCACCCACCGCCGCGGCGCGGGGGCGCCGCGGTGGGCGGAGGA
GGACGCCGTCGACTGGGGCCTCCTCCTCGGCGACGCCTACCACCGCTGCGGCGAGGTCTG
CGCCGAGTACGCCAAGACCTTCTACCTAGGTACTCAGCTTATGACTCCTGAAAGGCGCAA
AGCTGTCTGGGCAATCTATGTATGGTGCAGAAGAACTGATGAACTGGTAGATGGCCCTAA
CTCGTCTTACATTACACCAAAGGCACTTGATCGATGGGAGAAGAGATTAGAAGATCTCTT
CGAAGGCAGGCCATATGATATGTATGATGCAGCCCTCTCGGACACAGTGTCAAAGTTTCC
AGTAGATATCCAGCCATTCAAAGACATGATTGAAGGAATGAGGCTTGACCTGTGGAAATC
AAGGTATAGGAGCTTTGATGAGCTCTACCTCTACTGCTACTACGTTGCTGGCACGGTTGG
TCTCATGACAGTACCGGTGATGGGGATTGCCCCCGACTCGAAGGCCTCAACCGAGAGCGT
GTACAACGCTGCGCTAGCTCTTGGGATCGCCAACCAGCTGACGAATATTCTCAGAGACGT
AGGCGAAGACTCAAGGAGGGGAAGAATCTACCTTCCATTGGATGAATTGGCAGAGGCAGG
TCTGACAGAAGAAGACATATTCAGAGGGAAAGTGACTGATAAATGGAGGAAGTTCATGAA
GGGACAAATTCTGCGTGCCAGGTTATTCTTTGATGAGGCGGAGAAGGGCGTTGCGCATCT
AGACTCTGCGAGTAGATGGCCGGTTCTGGCATCTTTGTGGTTATACCGGCAGATCCTTGA
TGCTATCGAAGCAAACGACTACAACAACTTCACCAAGCGCGCGTATGTAAACAAGGCAAA
GAAGCTGCTGTCTTTACCGGTCGCTTATGCAAGAGCGGCAGTTGCATCATGAACAATCAC
TAGATCAGATGCCTTATTATTTTTTTTCTTTCATTTTCTTTTCTTTTGATTTCGCACGAT
TTCTTGGCTGTTGTATATATTCAAGCAGCTACCTGTATGCCATAAGCCTGCCACAGTTTT
TCTTTAGTTCAAGGGACTGATTTCAGGTCCCTCAATACTCAACTCTTGTTAGAAACAAAT
ACAGAGGGGGTAAGCCCCACAGTTCAAGAAGCATATTACTCT

CDS

1197 bp

>Os12t0626400-02 Phytoene synthase 2, Carotenoid biosynthesis
ATGGCGTCCTCCTCGTCGGCGGCGGCGCTCTGGACGGCGGCGCCCCACCCCCACGGCAGC
TGCATCAGGATCCACGCCATCTTCCACCAGCGTCACCAGCGGAGGGGGAGGAGGCCGGTC
GTCGTCGCCTCGTCGGTGAGGCCGCTGCAGGCCGCGAGCCTGGCGGTGGCCACGGCGCCG
GTGGCCGTGGCGTCGAGGAGGACGGCGGCGGAGGAGGCCGTCTACGAGGTCGTGCTGCGG
CAGGCGGCGCTGGTGGAGGAGGCCACCCACCGCCGCGGCGCGGGGGCGCCGCGGTGGGCG
GAGGAGGACGCCGTCGACTGGGGCCTCCTCCTCGGCGACGCCTACCACCGCTGCGGCGAG
GTCTGCGCCGAGTACGCCAAGACCTTCTACCTAGGTACTCAGCTTATGACTCCTGAAAGG
CGCAAAGCTGTCTGGGCAATCTATGTATGGTGCAGAAGAACTGATGAACTGGTAGATGGC
CCTAACTCGTCTTACATTACACCAAAGGCACTTGATCGATGGGAGAAGAGATTAGAAGAT
CTCTTCGAAGGCAGGCCATATGATATGTATGATGCAGCCCTCTCGGACACAGTGTCAAAG
TTTCCAGTAGATATCCAGCCATTCAAAGACATGATTGAAGGAATGAGGCTTGACCTGTGG
AAATCAAGGTATAGGAGCTTTGATGAGCTCTACCTCTACTGCTACTACGTTGCTGGCACG
GTTGGTCTCATGACAGTACCGGTGATGGGGATTGCCCCCGACTCGAAGGCCTCAACCGAG
AGCGTGTACAACGCTGCGCTAGCTCTTGGGATCGCCAACCAGCTGACGAATATTCTCAGA
GACGTAGGCGAAGACTCAAGGAGGGGAAGAATCTACCTTCCATTGGATGAATTGGCAGAG
GCAGGTCTGACAGAAGAAGACATATTCAGAGGGAAAGTGACTGATAAATGGAGGAAGTTC
ATGAAGGGACAAATTCTGCGTGCCAGGTTATTCTTTGATGAGGCGGAGAAGGGCGTTGCG
CATCTAGACTCTGCGAGTAGATGGCCGGTTCTGGCATCTTTGTGGTTATACCGGCAGATC
CTTGATGCTATCGAAGCAAACGACTACAACAACTTCACCAAGCGCGCGTATGTAAACAAG
GCAAAGAAGCTGCTGTCTTTACCGGTCGCTTATGCAAGAGCGGCAGTTGCATCATGA

Protein

399 aa

>Os12t0626400-02 Phytoene synthase 2, Carotenoid biosynthesis
MASSSSAAALWTAAPHPHGSCIRIHAIFHQRHQRRGRRPVVVASSVRPLQAASLAVATAP
VAVASRRTAAEEAVYEVVLRQAALVEEATHRRGAGAPRWAEEDAVDWGLLLGDAYHRCGE
VCAEYAKTFYLGTQLMTPERRKAVWAIYVWCRRTDELVDGPNSSYITPKALDRWEKRLED
LFEGRPYDMYDAALSDTVSKFPVDIQPFKDMIEGMRLDLWKSRYRSFDELYLYCYYVAGT
VGLMTVPVMGIAPDSKASTESVYNAALALGIANQLTNILRDVGEDSRRGRIYLPLDELAE
AGLTEEDIFRGKVTDKWRKFMKGQILRARLFFDEAEKGVAHLDSASRWPVLASLWLYRQI
LDAIEANDYNNFTKRAYVNKAKKLLSLPVAYARAAVAS*

5'UTR

chr12:26783525..26783579 (- strand) : 55 bp

CDS

chr12:26783131..26783524 (- strand) : 394 bp

chr12:26782096..26782146 (- strand) : 51 bp

chr12:26781808..26781980 (- strand) : 173 bp

chr12:26781443..26781678 (- strand) : 236 bp

chr12:26780971..26781163 (- strand) : 193 bp

chr12:26780734..26780883 (- strand) : 150 bp

3'UTR

chr12:26780504..26780733 (- strand) : 230 bp

FASTA

>Os12t0626400-02 class=Sequence position=chr12:26780504..26783579 (- strand)
CCCAACCATT CGACCCGCGC AGCGAGCCCC AACCCCACAT CGCCGCGCGC CCCCGATGGC GTCCTCCTCG TCGGCGGCGG
CGCTCTGGAC GGCGGCGCCC CACCCCCACG GCAGCTGCAT CAGGATCCAC GCCATCTTCC ACCAGCGTCA CCAGCGGAGG
GGGAGGAGGC CGGTCGTCGT CGCCTCGTCG GTGAGGCCGC TGCAGGCCGC GAGCCTGGCG GTGGCCACGG CGCCGGTGGC
CGTGGCGTCG AGGAGGACGG CGGCGGAGGA GGCCGTCTAC GAGGTCGTGC TGCGGCAGGC GGCGCTGGTG GAGGAGGCCA
CCCACCGCCG CGGCGCGGGG GCGCCGCGGT GGGCGGAGGA GGACGCCGTC GACTGGGGCC TCCTCCTCGG CGACGCCTAC
CACCGCTGCG GCGAGGTCTG CGCCGAGTAC GCCAAGACCT TCTACCTAGG TCAGCCAACC CAACATTGAC TAATCATTCA
ATTTTGTTTT TGTCACCGTT ATTACTTTAT CATTTCACAG GTGAAAGCTA GCTACTATTC GTTTGCCACT ACTACTCCCT
AGCTTAGCTA GCGTCTCTTC CTTTTCTTGA TTTGTTCATA GTACTGTATA TGATAATTGT AGACCTACCC TTTCTCTATT
TCTTTTTGGG TTCTTGGGTG GAATGGCTGG CTTGATAAAA TTTTGCGACC CTTTTTGTGG TTCTAGGAGC CACATCTCAC
TTTCACTTTC TTGTACTTGT TGGTCTAAAA AGATTAGTTA ATGCTGCAAT TAGTTGGCTT TTACTAGGAA TTGTAAGAGG
GTGGTGTTAA AAGGTGATTA AAAAAAAATC TATGAACATT CCTAGATTCC TATTACGTGT TAAGAAGATA AATATTCCTG
CGTATAATTT ATGGAATACT CCTTCTGATG GCAAAAATAT ATTAGCAGTA GCCAAACAAC ACCAGCCTGA GTGAGTGAGT
GGCTCTCAGT GCTCTGAACA ACTGTACATG TATATACAAA TGTTTGCCGA CTTCAGAGTA GGTAAGATAA TGCACTTGGA
TGATAGATGC CATCCCAAGG AAATGATCCA ACAAGCAGAT GCGCAGATAT GGTGATCTCT CTAGTGCACC ACTGGCAATT
TATAGATTTC TCTTCTTAAT TAGGGTCAGG GATATGCTGG TTGGTGGTGG GTTTGTGGGT GATGTGAGGA CGCATGGGCT
TGATTGATGA ATCCAGTAAC CTTCTTGTTT TTTTTAATCT TGCTTTCTGT ATCACCGTGT TTCCACTTGG ATCATCCCTG
ACCTGGTAAG GGACTCATTT TCTATTGCTA TGAGGACCTT TTGGGGACTA GCTCAAACTC TGATGTATGG TTGATACTTA
GATTTTCTAC GTAAAGTGGA ATTTCACCTT GTGTAATTTC TCATGGTTTT TGTTTCCATC GTTTACATTT CAGGTACTCA
GCTTATGACT CCTGAAAGGC GCAAAGCTGT CTGGGCAATC TATGGTATGG ATTAGTTAAC TATTCATTGA TCTACCAGTT
ACTCTCACTT GTGAAAATTC AGATAACTTC AATTGTTTGT GGAATTTTTA ATTCTTACCT TTGTTTTTGT CTTTGGCAGT
ATGGTGCAGA AGAACTGATG AACTGGTAGA TGGCCCTAAC TCGTCTTACA TTACACCAAA GGCACTTGAT CGATGGGAGA
AGAGATTAGA AGATCTCTTC GAAGGCAGGC CATATGATAT GTATGATGCA GCCCTCTCGG ACACAGTGTC AAAGTTTCCA
GTAGATATCC AGGTACAGCC AACAAAAAAG CTACTGTAAA AGCAGGATAT GAAGTGCTTT TAAAAGTTAT TAGTACACAG
TAAATTGGTG ACACGCATTT GTCTGATGTT TCTGCACCGT CGGGATCTCT TTTATTTACA GCCATTCAAA GACATGATTG
AAGGAATGAG GCTTGACCTG TGGAAATCAA GGTATAGGAG CTTTGATGAG CTCTACCTCT ACTGCTACTA CGTTGCTGGC
ACGGTTGGTC TCATGACAGT ACCGGTGATG GGGATTGCCC CCGACTCGAA GGCCTCAACC GAGAGCGTGT ACAACGCTGC
GCTAGCTCTT GGGATCGCCA ACCAGCTGAC GAATATTCTC AGAGACGTAG GCGAAGAGTA AGTACCAATG TGCTCACTAC
CAGCATGTTC TTTTTCTGAG TTAATAATTG CAGACTTTCA CATGATAAAT ATGTAGTTTG ACACCCAATA TGTATTGCAC
AAACCATTTG CGCTTTAAAG TCTAGTCCAA AATTGTGCCT AAACAGATGC CTTTCACATT AAAAATTTGA AGCGCACATA
AGTTTAATTT AAGGCATATG TACCGATTTG TCGCTATTGA GATTAAGTTT TTTGGTTGAT TGTGATGTAA TATGTTTGTT
GTGGATGGAA TTTCAGCTCA AGGAGGGGAA GAATCTACCT TCCATTGGAT GAATTGGCAG AGGCAGGTCT GACAGAAGAA
GACATATTCA GAGGGAAAGT GACTGATAAA TGGAGGAAGT TCATGAAGGG ACAAATTCTG CGTGCCAGGT TATTCTTTGA
TGAGGCGGAG AAGGGCGTTG CGCATCTAGA CTCTGCGAGT AGATGGCCGG TATGAGAGGC TACAAATTCT GCGGTTTTAT
GTTCCACAAA TAAAATAAAC CACTGAAATT TACCTTAATC GATTATTTTC TCGTAGGTTC TGGCATCTTT GTGGTTATAC
CGGCAGATCC TTGATGCTAT CGAAGCAAAC GACTACAACA ACTTCACCAA GCGCGCGTAT GTAAACAAGG CAAAGAAGCT
GCTGTCTTTA CCGGTCGCTT ATGCAAGAGC GGCAGTTGCA TCATGAACAA TCACTAGATC AGATGCCTTA TTATTTTTTT
TCTTTCATTT TCTTTTCTTT TGATTTCGCA CGATTTCTTG GCTGTTGTAT ATATTCAAGC AGCTACCTGT ATGCCATAAG
CCTGCCACAG TTTTTCTTTA GTTCAAGGGA CTGATTTCAG GTCCCTCAAT ACTCAACTCT TGTTAGAAAC AAATACAGAG
GGGGTAAGCC CCACAGTTCA AGAAGCATAT TACTCT

Locus: Os12g0626400

Loading...

Locus: Os12g0626400

Loading...