Os12t0630100-01

Locus

Os12g0630100

Description

Thaumatin protein, Tolerance to nitrogen deficiency

RAP-DB Gene Symbol Synonym(s)

TOND1

RAP-DB Gene Name Synonym(s)

Tolerance Of Nitrogen Deficiency 1, Thaumatin

CGSNL Gene Symbol

TOND1

CGSNL Gene Name

TOLERANCE OF NITROGEN DEFICIENCY 1

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Thaumatin, Tolerance Of Nitrogen Deficiency 1

Transcript Evidence

AK069182

Inferred from literature (Tequing)

Protein Evidence

Q2QLS8

Literature

PMID: 25439309

Note

  • Nipponbare: intolerant to N deficiency, 93-11: tolerant to N deficiency, 5 SNPs leads to the increase in N-deficiency tolerance.

Manual Curation

February 6, 2015

Functional domain (InterPro)

Thaumatin (IPR001938)

Thaumatin, conserved site (IPR017949)

Full-length cDNA

J023009L15 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0630100-01)

Others

Oryzabase (14717)

KEGG (Os12t0630100-01)

Transcript

692 bp

>Os12t0630100-01 Thaumatin protein, Tolerance to nitrogen deficiency
AATTAACAAGCTATACAAATTAACACAAAGATTAGAAGAAAGCAAGCAACAATGGCGTCA
GCTCCGGCCGCCTCTTCCGCAGTGCTCCTCGTCGTGGTCCTGGTGGCGAGCCTCGCCGCC
GGCGGCGCCAACGCGGCGACCTTCACCATCACCAACCGTTGCTCGTTCACGGTGTGGCCG
GCGGCGACGCCGGTGGGCGGCGGCACGCAGCTGAACCCGGGGCAGACGTGGACCATCAAC
GTGCCCGCCGGGACCAGCTCCGGCAGGGTGTGGGGCCGGACCGGGTGCAGCTTCGACGGC
GCCGGCCGCGGCAGGTGCGCCACCGGCGACTGCGGCGGCGCGCTGTCGTGCAGGCTGTCC
GGGCAGCCGCCGCTGACGCTGGCGGAGTTCACGCTGGGGACGTCCGGCGGCAACCGGGAC
TTCTACAACCTGTCGGTGATCGACGGGTACAACGTCGCCATGAGCTTCTCCTGCAGCTCC
GGCGTGACGCTGACGTGCAGGGAGAGGAGCTGCCCGGACGCGTACCAGTACCCCTCCGAC
GATTCCAAGCTGCGCTCCTGCAACGGCAACAGCAACTACCGAGTCGTCTTCTGCCCATGA
TTTCATGCATATGAACCTACTACTATATATATACTTCTACTAAACTGTATCAGGGAAAAT
AATAAGAACATACAATAAAACGAACGTGATCC

CDS

549 bp

>Os12t0630100-01 Thaumatin protein, Tolerance to nitrogen deficiency
ATGGCGTCAGCTCCGGCCGCCTCTTCCGCAGTGCTCCTCGTCGTGGTCCTGGTGGCGAGC
CTCGCCGCCGGCGGCGCCAACGCGGCGACCTTCACCATCACCAACCGTTGCTCGTTCACG
GTGTGGCCGGCGGCGACGCCGGTGGGCGGCGGCACGCAGCTGAACCCGGGGCAGACGTGG
ACCATCAACGTGCCCGCCGGGACCAGCTCCGGCAGGGTGTGGGGCCGGACCGGGTGCAGC
TTCGACGGCGCCGGCCGCGGCAGGTGCGCCACCGGCGACTGCGGCGGCGCGCTGTCGTGC
AGGCTGTCCGGGCAGCCGCCGCTGACGCTGGCGGAGTTCACGCTGGGGACGTCCGGCGGC
AACCGGGACTTCTACAACCTGTCGGTGATCGACGGGTACAACGTCGCCATGAGCTTCTCC
TGCAGCTCCGGCGTGACGCTGACGTGCAGGGAGAGGAGCTGCCCGGACGCGTACCAGTAC
CCCTCCGACGATTCCAAGCTGCGCTCCTGCAACGGCAACAGCAACTACCGAGTCGTCTTC
TGCCCATGA

Protein

183 aa

>Os12t0630100-01 Thaumatin protein, Tolerance to nitrogen deficiency
MASAPAASSAVLLVVVLVASLAAGGANAATFTITNRCSFTVWPAATPVGGGTQLNPGQTW
TINVPAGTSSGRVWGRTGCSFDGAGRGRCATGDCGGALSCRLSGQPPLTLAEFTLGTSGG
NRDFYNLSVIDGYNVAMSFSCSSGVTLTCRERSCPDAYQYPSDDSKLRSCNGNSNYRVVF
CP*

5'UTR

chr12:26956844..26956894 (- strand) : 51 bp

CDS

chr12:26956295..26956843 (- strand) : 549 bp

3'UTR

chr12:26956203..26956294 (- strand) : 92 bp

FASTA

>Os12t0630100-01 class=Sequence position=chr12:26956203..26956894 (- strand)
AATTAACAAG CTATACAAAT TAACACAAAG ATTAGAAGAA AGCAAGCAAC AATGGCGTCA GCTCCGGCCG CCTCTTCCGC
AGTGCTCCTC GTCGTGGTCC TGGTGGCGAG CCTCGCCGCC GGCGGCGCCA ACGCGGCGAC CTTCACCATC ACCAACCGTT
GCTCGTTCAC GGTGTGGCCG GCGGCGACGC CGGTGGGCGG CGGCACGCAG CTGAACCCGG GGCAGACGTG GACCATCAAC
GTGCCCGCCG GGACCAGCTC CGGCAGGGTG TGGGGCCGGA CCGGGTGCAG CTTCGACGGC GCCGGCCGCG GCAGGTGCGC
CACCGGCGAC TGCGGCGGCG CGCTGTCGTG CAGGCTGTCC GGGCAGCCGC CGCTGACGCT GGCGGAGTTC ACGCTGGGGA
CGTCCGGCGG CAACCGGGAC TTCTACAACC TGTCGGTGAT CGACGGGTAC AACGTCGCCA TGAGCTTCTC CTGCAGCTCC
GGCGTGACGC TGACGTGCAG GGAGAGGAGC TGCCCGGACG CGTACCAGTA CCCCTCCGAC GATTCCAAGC TGCGCTCCTG
CAACGGCAAC AGCAACTACC GAGTCGTCTT CTGCCCATGA TTTCATGCAT ATGAACCTAC TACTATATAT ATACTTCTAC
TAAACTGTAT CAGGGAAAAT AATAAGAACA TACAATAAAA CGAACGTGAT CC

Locus: Os12g0630100

Loading...

Locus: Os12g0630100

Loading...