Os12t0631100-01

Locus

Os12g0631100

Description

Small GTPase, Storage protein trafficking

RAP-DB Gene Symbol Synonym(s)

GLUP4, glup4(esp8), esp8, glup4, OsRab5B2, Rab5a, OsRab5a, gpa1, GPA1/Rab5a

RAP-DB Gene Name Synonym(s)

GLUTELIN PRECURSOR 4, glutelin precursor4, glutelin precursor 4, glutelin precursor-4, small GTP-binding protein OsRab5B2, small GTP-binding protein OsRab5a, glutelin precursor mutant4, glutelin precursor accumulation 1

CGSNL Gene Symbol

GLUP4

CGSNL Gene Name

GLUTELIN PRECURSOR 4

Oryzabase Gene Symbol Synonym(s)

glup4(esp8), esp8, glup4, OsRab5B2, Rab5a, OsRab5a, gpa1, GPA1/Rab5a, GPA, GLUP4/Rab5, GLUP4/Rab5a

Oryzabase Gene Name Synonym(s)

glutelin precursor4, glutelin precursor 4, glutelin precursor-4, small GTP-binding protein OsRab5B2, small GTP-binding protein OsRab5a, glutelin precursor mutant4, glutelin precursor accumulation 1

Transcript Evidence

AY029301 (Genbank)

AJ292320 (Genbank)

AK061116 (Genbank)

Protein Evidence

Q94IR3 (UniProt)

Q9FEV1 (UniProt)

Q0ILQ6 (UniProt)

Literature

PMID: 21105928

Note

Manual Curation

December 16, 2010

Gene Ontology (GO)

Biological Process: GTP catabolic process (GO:0006184)

Biological Process: intracellular protein transport (GO:0006886)

Biological Process: nucleocytoplasmic transport (GO:0006913)

Biological Process: signal transduction (GO:0007165)

Biological Process: small GTPase mediated signal transduction (GO:0007264)

Biological Process: protein transport (GO:0015031)

Cellular Component: intracellular (GO:0005622)

Cellular Component: membrane (GO:0016020)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Small GTPase superfamily (IPR001806)

Ran GTPase (IPR002041)

Small GTPase superfamily, Rho type (IPR003578)

Small GTPase superfamily, Rab type (IPR003579)

Small GTP-binding protein domain (IPR005225)

Small GTPase superfamily, Ras type (IPR020849)

Full-length cDNA

006-207-E04 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0631100-01)

RiceXPro (AK061116)

Others

Oryzabase (651)

KEGG (Os12t0631100-01)

Transcript

1044 bp

>Os12t0631100-01 Small GTPase, Storage protein trafficking
AGAGAAGCAAACCCAACAAAAAAAAAAAAAGAATTTTCAGGTTTTCTTCTCGCTTTCACC
GGAGAAGGAGAAGGAGAGGAAGGTGTTGATCGAATCCTCCTCCAATCGCGCGCGATTCGA
TCCCCGTTGCTGGCCGCTCGCTCGCTCGATCCCTCATCCGATCTGAATCCCCCGATCTGA
TGGCGGCCAACCCCGGCAACAAGATCCGCAACGCCAAGCTGGTTCTTCTTGGAGATGTGG
GCACGGGCAAGTCGAGCCTCGTTCTCCGGTTTGTGAAGGGCCAGTTTGTTGAGTTCCAGG
AGTCCACCATCGGCGCGGCCTTCTTCTCGCAAACCTTGGCGGTTAACGATGAGACGGTGA
AGTTCGAAATCTGGGATACTGCAGGGCAGGAGAGGTATCATAGCTTGGCTCCGATGTACT
ATCGGGGTGCGGCTGCCGCGATAGTTGTCTACGACATCACAAATGCGGCCTCTTTCACAC
GTGCAAAAAAATGGGTTCAAGAACTTCAAGCGCAAGgaaacccaaacacgataatggctc
ttgctggtaacaaggctgatatggtagaggcgaggcaggtgccagcagaaGAGGCAAAGA
CCTACGCACAAGAGAATGGCCTTTTCTTCATGGAAACATCTGCGAAAACGGCGATCAATG
TGAACGATGTATTCCACGAGATCGCAAAGAGATTGCTTCAAGGACAGCAGGCTCAAGACA
CACCGGCTGGAATGGTTCTCAACCAGAGACCAGCTGAGAGGATGGTGAGCAGTTCTTCAT
GCTGCTCATAATTCAAGTGTGGAGTATGTGACAACTACATAATGCCATGGCCTGAAATCC
AGGAGAAGTGTGTATGCAtcagagatgcacacaaagcttgtaaagtggctgctgccatcc
cagctgctgtttcttattttgtcatgttcgttctgtaaaTGTGAATACTAGGGTGTCGCT
GCAGAAATTCAGATGTATTACTACAGTGTATGCTCTTGCTTAAGTATTTCTCGACACTGA
AACAGAGTAAAGCAAAGTCTAGTC

CDS

612 bp

>Os12t0631100-01 Small GTPase, Storage protein trafficking
ATGGCGGCCAACCCCGGCAACAAGATCCGCAACGCCAAGCTGGTTCTTCTTGGAGATGTG
GGCACGGGCAAGTCGAGCCTCGTTCTCCGGTTTGTGAAGGGCCAGTTTGTTGAGTTCCAG
GAGTCCACCATCGGCGCGGCCTTCTTCTCGCAAACCTTGGCGGTTAACGATGAGACGGTG
AAGTTCGAAATCTGGGATACTGCAGGGCAGGAGAGGTATCATAGCTTGGCTCCGATGTAC
TATCGGGGTGCGGCTGCCGCGATAGTTGTCTACGACATCACAAATGCGGCCTCTTTCACA
CGTGCAAAAAAATGGGTTCAAGAACTTCAAGCGCAAGgaaacccaaacacgataatggct
cttgctggtaacaaggctgatatggtagaggcgaggcaggtgccagcagaaGAGGCAAAG
ACCTACGCACAAGAGAATGGCCTTTTCTTCATGGAAACATCTGCGAAAACGGCGATCAAT
GTGAACGATGTATTCCACGAGATCGCAAAGAGATTGCTTCAAGGACAGCAGGCTCAAGAC
ACACCGGCTGGAATGGTTCTCAACCAGAGACCAGCTGAGAGGATGGTGAGCAGTTCTTCA
TGCTGCTCATAA

Protein

204 aa

>Os12t0631100-01 Small GTPase, Storage protein trafficking
MAANPGNKIRNAKLVLLGDVGTGKSSLVLRFVKGQFVEFQESTIGAAFFSQTLAVNDETV
KFEIWDTAGQERYHSLAPMYYRGAAAAIVVYDITNAASFTRAKKWVQELQAQGNPNTIMA
LAGNKADMVEARQVPAEEAKTYAQENGLFFMETSAKTAINVNDVFHEIAKRLLQGQQAQD
TPAGMVLNQRPAERMVSSSSCCS*

5'UTR

chr12:27022013..27022191 (+ strand) : 179 bp

CDS

chr12:27022192..27022233 (+ strand) : 42 bp

chr12:27022497..27022574 (+ strand) : 78 bp

chr12:27022670..27022837 (+ strand) : 168 bp

chr12:27023697..27023745 (+ strand) : 49 bp

chr12:27023947..27024020 (+ strand) : 74 bp

chr12:27024555..27024648 (+ strand) : 94 bp

chr12:27024787..27024893 (+ strand) : 107 bp

3'UTR

chr12:27024894..27025146 (+ strand) : 253 bp

FASTA

>Os12t0631100-01 class=Sequence position=chr12:27022013..27025146 (+ strand)
AGAGAAGCAA ACCCAACAAA AAAAAAAAAA GAATTTTCAG GTTTTCTTCT CGCTTTCACC GGAGAAGGAG AAGGAGAGGA
AGGTGTTGAT CGAATCCTCC TCCAATCGCG CGCGATTCGA TCCCCGTTGC TGGCCGCTCG CTCGCTCGAT CCCTCATCCG
ATCTGAATCC CCCGATCTGA TGGCGGCCAA CCCCGGCAAC AAGATCCGCA ACGCCAAGCT GGTGAGGAAT CAAACGTCTC
CCTCAATTTG GTTTCTTGAT TTGTTTTTGT TTCCCCCTGG ATTTAGGGCT GATGATATTT CCCCCTAAGA TCCCTCCTTG
TTGGTCGCGA TTAGATTGAT GAACTGATTC CCCCTTATTA TGATCGTAAA ACAAGAACTC AATCTTTACT TATTGGCATC
ATGTGCTCAT GTTGTTCATG TATCACGAAT TCCGGGTCTT GGGAGTATGT TGGTATGCGT TTACTAACAG TGTTGATTAA
CCAGGTTCTT CTTGGAGATG TGGGCACGGG CAAGTCGAGC CTCGTTCTCC GGTTTGTGAA GGGCCAGTTT GTTGAGTTCC
AGGTGAATTT CTTTTACACG TGAACTACTA TGACCTAAGA TTGAGCAGGT TTGGTGTGTT GGGATAGGCT TGATTTTGTT
GGTTCATTCG GATGCAGGAG TCCACCATCG GCGCGGCCTT CTTCTCGCAA ACCTTGGCGG TTAACGATGA GACGGTGAAG
TTCGAAATCT GGGATACTGC AGGGCAGGAG AGGTATCATA GCTTGGCTCC GATGTACTAT CGGGGTGCGG CTGCCGCGAT
AGTTGTCTAC GACATCACAA ATGCGGTTAG TACAAGACTA AGTGACTTGC TTGAATTTTA ATTAAGTTGT ACATCTTGAT
GATAGTTTCT CAAAGTTTTG ATTTAATGCA ATCATGCCTG CATATCACTG AAAATTATAA GTACGGCACC ACAGCCGCGA
TTGGTAGAAA TTACTAACAG TCTAATAATA TAATTTACGC CATTGAAACC AGAATTACGA TTAGTAAGTA TTGGTAAAAT
CACCCCTTCT CTGTGATTAA CATATCGAAC CAAGTATTCA TGATAATCGT ACACCAACTT TGACATTTTA ATCCATCATC
TTTTATTGTC ACAGAAGATT CGAACTTCCT ACATATAGTT TTAGGTTATA TTGCTCTTCT GGTCTTGGTT CAAGTGTGGC
CATGTTTTCC CAGATGATAG ACTGATGAGT TGGTTCTGCC ATTACCAATT AGCAACTCCC ATGTCCTGGC GTTATGGCAC
ACTGATAGTA GATCAACTAG TTATCTTCAC TGTTTTTGCA CCTTGTTTGC ATCTTATGAG CAAGCCCTAT TCGGAGAAGA
TACTGTATCT ATTGTGTGCC CTTACTTGAA CGGAGGAACC CTTCAATTCA CGGTCTTGCG ATCTTATGTA TTAGCATATT
AGCAACGCAT CTCTTTATAT TTTTCTTGCT TCACATGCAG CTTTTAGTGT GTGTTCTTGG TAAACATGAT TTCGATCTGC
ATTACAAGTT TTTGGGAAGA AATAAATATA TCATAGTTGA TAGTTTACAC CGTGCACAAA TTTAAGTCTA ACTTCATTCA
TACTGTTTTA TCTGAGTATG CTCACTGCTC ATTTTGTAAA AGTGGTGCTA ATAGTGGTTC TCATCATTAT TTTCTGCCTT
TTAGGCCTCT TTCACACGTG CAAAAAAATG GGTTCAAGAA CTTCAAGCGC AAGGTAATCC ATTTCTCTTT TTGTAATTTT
CACGTATGAT TAGAACATCT GTAAATAAGC AGCTATATTG ATTTTGTACA ACTGCTGGAC CACCTGTACT GTACAGTTCT
CTTATAAGTG AACTTGCAAT TTCATAGCAC TATAAGACAT CGTGTCTGTT TTTTTAATAG TCCAGCTAAT ACAAGTTAAC
ttctttttat acaggaaacc caaacacgat aatggctctt gctggtaaca aggctgatat ggtagaggcg aggcaggtgc
cagcagaagt atgtaatttt gcttctcaaa tccctttttT TGTGATTATA TGTCAAAGCA CTAGTGCATT TCTGCATGAA
ACTATCATGT CACTGTGATT TGATATTTGT CACTAGCATC TCATAATGGT GCTTATTTTC CTCATTGCTT CGAGCAAAAG
TATAATTTGG CCTTACCAGC TTCAAATTAC TGTATTTTTC TCCTGTCACA TTTGACGATG AATTATCAGT ATGTTGTGAT
AGTGAATAGC ACAGAATAAC TATGTCTACT TTTTGTTGCT CCTGCTTCAT TGAAAAAATA ACTCTGAATT GAAGTATTTA
ACAAAAAAAT ATATAATAAA AAGTTGTGAA GGCAAGAAGG TTTTCTGTTC TGTGGTGGTC TTTTTTGTTT GCTCATTGCA
ACACTGATCT ATTAAATAAT AGATACCATC TTTTGTGTTT GTGGCACTAT CCTGTTCTTG AAATGAATTT CTTTTCCATT
ATGACAGCCT CTGCGGCTTG CTTTGTTGAT GCTTATCAAA AGCTCTAATT TGTATGGTGC AGGAGGCAAA GACCTACGCA
CAAGAGAATG GCCTTTTCTT CATGGAAACA TCTGCGAAAA CGGCGATCAA TGTGAACGAT GTATTCCACG AGATCGGTGA
GTTTAGATCA CAAATCATTT CCGCAGTGGA TTTCTGTACG CCGACAGAGC TGGTTGGTTA TTTGGTGTAC AAAAATGTAC
ACAGCCTGCT TCTGCTAATT TCTAAGCGAA TTTGCATTCT TAATCTGATT TCAGCAAAGA GATTGCTTCA AGGACAGCAG
GCTCAAGACA CACCGGCTGG AATGGTTCTC AACCAGAGAC CAGCTGAGAG GATGGTGAGC AGTTCTTCAT GCTGCTCATA
ATTCAAGTGT GGAGTATGTG ACAACTACAT AATGCCATGG CCTGAAATCC AGGAGAAGTG TGTATGCAtc agagatgcac
acaaagcttg taaagtggct gctgccatcc cagctgctgt ttcttatttt gtcatgttcg ttctgtaaaT GTGAATACTA
GGGTGTCGCT GCAGAAATTC AGATGTATTA CTACAGTGTA TGCTCTTGCT TAAGTATTTC TCGACACTGA AACAGAGTAA
AGCAAAGTCT AGTC

Locus: Os12g0631100

Loading...

Locus: Os12g0631100

Loading...