Os12t0631100-02

Locus

Os12g0631100

Description

Ras domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GLUP4

CGSNL Gene Name

GLUTELIN PRECURSOR 4

Oryzabase Gene Symbol Synonym(s)

glup4(esp8), esp8, glup4, OsRab5B2, Rab5a, OsRab5a, gpa1, GPA1/Rab5a, GPA, GLUP4/Rab5, GLUP4/Rab5a

Oryzabase Gene Name Synonym(s)

glutelin precursor4, glutelin precursor 4, glutelin precursor-4, small GTP-binding protein OsRab5B2, small GTP-binding protein OsRab5a, glutelin precursor mutant4, glutelin precursor accumulation 1

Transcript Evidence

AK066784 (DDBJ, Best hit)

Protein Evidence

Q9FEV1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: GTP catabolic process (GO:0006184)

Biological Process: intracellular protein transport (GO:0006886)

Biological Process: nucleocytoplasmic transport (GO:0006913)

Biological Process: signal transduction (GO:0007165)

Biological Process: small GTPase mediated signal transduction (GO:0007264)

Biological Process: protein transport (GO:0015031)

Cellular Component: intracellular (GO:0005622)

Cellular Component: membrane (GO:0016020)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Small GTPase superfamily (IPR001806)

Ran GTPase (IPR002041)

Small GTPase superfamily, Rho type (IPR003578)

Small GTPase superfamily, Rab type (IPR003579)

Small GTP-binding protein domain (IPR005225)

Small GTPase superfamily, Ras type (IPR020849)

Full-length cDNA

J013078I11 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0631100-02)

RiceXPro (AK066784)

Others

Oryzabase (651)

KEGG (Os12t0631100-02)

Transcript

1032 bp

>Os12t0631100-02 Ras domain containing protein.
GAAGGAGAGGAAGGTGTTGATCGAATCCTCCTCCAATCGCGCGCGATTCGATCCCCGTTG
CTGGCCGCTCGCTCGCTCGATCCCTCATCCGATCTGAATCCCCCGATCTGATGGCGGCCA
ACCCCGGCAACAAGATCCGCAACGCCAAGCTGGTTCTTCTTGGAGATGTGGGCACGGGCA
AGTCGAGCCTCGTTCTCCGGTTTGTGAAGGGCCAGTTTGTTGAGTTCCAGGAGTCCACCA
TCGGCGCGGCCTTCTTCTCGCAAACCTTGGCGGTTAACGATGAGACGGTGAAGTTCGAAA
TCTGGGATACTGCAGGGCAGGAGAGGTATCATAGCTTGGCTCCGATGTACTATCGGGGTG
CGGCTGCCGCGATAGTTGTCTACGACATCACAAATGCGGCCTCTTTCACACGTGCAAAAA
AATGGGTTCAAGAACTTCAAGCGCAAGgaaacccaaacacgataatggctcttgctggta
acaaggctgatatggtagaggcgaggcaggtgccagcagaaGAGGCAAAGACCTACGCAC
AAGAGAATGGCCTTTTCTTCATGGAAACATCTGCGAAAACGGCGATCAATGTGAACGATG
TATTCCACGAGATCGCAAAGAGATTGCTTCAAGGACAGCAGGCTCAAGACACACCGGCTG
GAATGGTTCTCAACCAGAGACCAGCTGAGAGGATGGTGAGCAGTTCTTCATGCTGCTCAT
AATTCAAGTGTGGAGTATGTGACAACTACATAATGCCATGGCCTGAAATCCAGGAGAAGT
GTGTATGCAtcagagatgcacacaaagcttgtaaagtggctgctgccatcccagctgctg
tttcttattttgtcatgttcgttctgtaaaTGTGAATACTAGGGTGTCGCTGCAGAAATT
CAGATGTATTACTACAGTGTATGCTCTTGCTTAAGTATTTCTCGACACTGAAACAGAGTA
AAGCAAAGTCTAGTCAGATTCGTTTTGTTTGCTTCAATTCAGATCATGCAGTGAGCTTGC
TTTTTACATTCT

CDS

612 bp

>Os12t0631100-02 Ras domain containing protein.
ATGGCGGCCAACCCCGGCAACAAGATCCGCAACGCCAAGCTGGTTCTTCTTGGAGATGTG
GGCACGGGCAAGTCGAGCCTCGTTCTCCGGTTTGTGAAGGGCCAGTTTGTTGAGTTCCAG
GAGTCCACCATCGGCGCGGCCTTCTTCTCGCAAACCTTGGCGGTTAACGATGAGACGGTG
AAGTTCGAAATCTGGGATACTGCAGGGCAGGAGAGGTATCATAGCTTGGCTCCGATGTAC
TATCGGGGTGCGGCTGCCGCGATAGTTGTCTACGACATCACAAATGCGGCCTCTTTCACA
CGTGCAAAAAAATGGGTTCAAGAACTTCAAGCGCAAGgaaacccaaacacgataatggct
cttgctggtaacaaggctgatatggtagaggcgaggcaggtgccagcagaaGAGGCAAAG
ACCTACGCACAAGAGAATGGCCTTTTCTTCATGGAAACATCTGCGAAAACGGCGATCAAT
GTGAACGATGTATTCCACGAGATCGCAAAGAGATTGCTTCAAGGACAGCAGGCTCAAGAC
ACACCGGCTGGAATGGTTCTCAACCAGAGACCAGCTGAGAGGATGGTGAGCAGTTCTTCA
TGCTGCTCATAA

Protein

204 aa

>Os12t0631100-02 Ras domain containing protein.
MAANPGNKIRNAKLVLLGDVGTGKSSLVLRFVKGQFVEFQESTIGAAFFSQTLAVNDETV
KFEIWDTAGQERYHSLAPMYYRGAAAAIVVYDITNAASFTRAKKWVQELQAQGNPNTIMA
LAGNKADMVEARQVPAEEAKTYAQENGLFFMETSAKTAINVNDVFHEIAKRLLQGQQAQD
TPAGMVLNQRPAERMVSSSSCCS*

5'UTR

chr12:27022082..27022191 (+ strand) : 110 bp

CDS

chr12:27022192..27022233 (+ strand) : 42 bp

chr12:27022497..27022574 (+ strand) : 78 bp

chr12:27022670..27022837 (+ strand) : 168 bp

chr12:27023697..27023745 (+ strand) : 49 bp

chr12:27023947..27024020 (+ strand) : 74 bp

chr12:27024555..27024648 (+ strand) : 94 bp

chr12:27024787..27024893 (+ strand) : 107 bp

3'UTR

chr12:27024894..27025203 (+ strand) : 310 bp

FASTA

>Os12t0631100-02 class=Sequence position=chr12:27022082..27025203 (+ strand)
GAAGGAGAGG AAGGTGTTGA TCGAATCCTC CTCCAATCGC GCGCGATTCG ATCCCCGTTG CTGGCCGCTC GCTCGCTCGA
TCCCTCATCC GATCTGAATC CCCCGATCTG ATGGCGGCCA ACCCCGGCAA CAAGATCCGC AACGCCAAGC TGGTGAGGAA
TCAAACGTCT CCCTCAATTT GGTTTCTTGA TTTGTTTTTG TTTCCCCCTG GATTTAGGGC TGATGATATT TCCCCCTAAG
ATCCCTCCTT GTTGGTCGCG ATTAGATTGA TGAACTGATT CCCCCTTATT ATGATCGTAA AACAAGAACT CAATCTTTAC
TTATTGGCAT CATGTGCTCA TGTTGTTCAT GTATCACGAA TTCCGGGTCT TGGGAGTATG TTGGTATGCG TTTACTAACA
GTGTTGATTA ACCAGGTTCT TCTTGGAGAT GTGGGCACGG GCAAGTCGAG CCTCGTTCTC CGGTTTGTGA AGGGCCAGTT
TGTTGAGTTC CAGGTGAATT TCTTTTACAC GTGAACTACT ATGACCTAAG ATTGAGCAGG TTTGGTGTGT TGGGATAGGC
TTGATTTTGT TGGTTCATTC GGATGCAGGA GTCCACCATC GGCGCGGCCT TCTTCTCGCA AACCTTGGCG GTTAACGATG
AGACGGTGAA GTTCGAAATC TGGGATACTG CAGGGCAGGA GAGGTATCAT AGCTTGGCTC CGATGTACTA TCGGGGTGCG
GCTGCCGCGA TAGTTGTCTA CGACATCACA AATGCGGTTA GTACAAGACT AAGTGACTTG CTTGAATTTT AATTAAGTTG
TACATCTTGA TGATAGTTTC TCAAAGTTTT GATTTAATGC AATCATGCCT GCATATCACT GAAAATTATA AGTACGGCAC
CACAGCCGCG ATTGGTAGAA ATTACTAACA GTCTAATAAT ATAATTTACG CCATTGAAAC CAGAATTACG ATTAGTAAGT
ATTGGTAAAA TCACCCCTTC TCTGTGATTA ACATATCGAA CCAAGTATTC ATGATAATCG TACACCAACT TTGACATTTT
AATCCATCAT CTTTTATTGT CACAGAAGAT TCGAACTTCC TACATATAGT TTTAGGTTAT ATTGCTCTTC TGGTCTTGGT
TCAAGTGTGG CCATGTTTTC CCAGATGATA GACTGATGAG TTGGTTCTGC CATTACCAAT TAGCAACTCC CATGTCCTGG
CGTTATGGCA CACTGATAGT AGATCAACTA GTTATCTTCA CTGTTTTTGC ACCTTGTTTG CATCTTATGA GCAAGCCCTA
TTCGGAGAAG ATACTGTATC TATTGTGTGC CCTTACTTGA ACGGAGGAAC CCTTCAATTC ACGGTCTTGC GATCTTATGT
ATTAGCATAT TAGCAACGCA TCTCTTTATA TTTTTCTTGC TTCACATGCA GCTTTTAGTG TGTGTTCTTG GTAAACATGA
TTTCGATCTG CATTACAAGT TTTTGGGAAG AAATAAATAT ATCATAGTTG ATAGTTTACA CCGTGCACAA ATTTAAGTCT
AACTTCATTC ATACTGTTTT ATCTGAGTAT GCTCACTGCT CATTTTGTAA AAGTGGTGCT AATAGTGGTT CTCATCATTA
TTTTCTGCCT TTTAGGCCTC TTTCACACGT GCAAAAAAAT GGGTTCAAGA ACTTCAAGCG CAAGGTAATC CATTTCTCTT
TTTGTAATTT TCACGTATGA TTAGAACATC TGTAAATAAG CAGCTATATT GATTTTGTAC AACTGCTGGA CCACCTGTAC
TGTACAGTTC TCTTATAAGT GAACTTGCAA TTTCATAGCA CTATAAGACA TCGTGTCTGT TTTTTTAATA GTCCAGCTAA
TACAAGTTAA Cttcttttta tacaggaaac ccaaacacga taatggctct tgctggtaac aaggctgata tggtagaggc
gaggcaggtg ccagcagaag tatgtaattt tgcttctcaa atcccttttt TTGTGATTAT ATGTCAAAGC ACTAGTGCAT
TTCTGCATGA AACTATCATG TCACTGTGAT TTGATATTTG TCACTAGCAT CTCATAATGG TGCTTATTTT CCTCATTGCT
TCGAGCAAAA GTATAATTTG GCCTTACCAG CTTCAAATTA CTGTATTTTT CTCCTGTCAC ATTTGACGAT GAATTATCAG
TATGTTGTGA TAGTGAATAG CACAGAATAA CTATGTCTAC TTTTTGTTGC TCCTGCTTCA TTGAAAAAAT AACTCTGAAT
TGAAGTATTT AACAAAAAAA TATATAATAA AAAGTTGTGA AGGCAAGAAG GTTTTCTGTT CTGTGGTGGT CTTTTTTGTT
TGCTCATTGC AACACTGATC TATTAAATAA TAGATACCAT CTTTTGTGTT TGTGGCACTA TCCTGTTCTT GAAATGAATT
TCTTTTCCAT TATGACAGCC TCTGCGGCTT GCTTTGTTGA TGCTTATCAA AAGCTCTAAT TTGTATGGTG CAGGAGGCAA
AGACCTACGC ACAAGAGAAT GGCCTTTTCT TCATGGAAAC ATCTGCGAAA ACGGCGATCA ATGTGAACGA TGTATTCCAC
GAGATCGGTG AGTTTAGATC ACAAATCATT TCCGCAGTGG ATTTCTGTAC GCCGACAGAG CTGGTTGGTT ATTTGGTGTA
CAAAAATGTA CACAGCCTGC TTCTGCTAAT TTCTAAGCGA ATTTGCATTC TTAATCTGAT TTCAGCAAAG AGATTGCTTC
AAGGACAGCA GGCTCAAGAC ACACCGGCTG GAATGGTTCT CAACCAGAGA CCAGCTGAGA GGATGGTGAG CAGTTCTTCA
TGCTGCTCAT AATTCAAGTG TGGAGTATGT GACAACTACA TAATGCCATG GCCTGAAATC CAGGAGAAGT GTGTATGCAt
cagagatgca cacaaagctt gtaaagtggc tgctgccatc ccagctgctg tttcttattt tgtcatgttc gttctgtaaa
TGTGAATACT AGGGTGTCGC TGCAGAAATT CAGATGTATT ACTACAGTGT ATGCTCTTGC TTAAGTATTT CTCGACACTG
AAACAGAGTA AAGCAAAGTC TAGTCAGATT CGTTTTGTTT GCTTCAATTC AGATCATGCA GTGAGCTTGC TTTTTACATT
CT

Locus: Os12g0631100

Loading...

Locus: Os12g0631100

Loading...