Os12t0640600-01

Locus

Os12g0640600

Description

Carotenoid-cleavage dioxygenase

RAP-DB Gene Symbol Synonym(s)

OsCCD1

RAP-DB Gene Name Synonym(s)

carotenoid-cleavage dioxygenase 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCCD1, CCD1

Oryzabase Gene Name Synonym(s)

carotenoid cleavage dioxygenase 1

Transcript Evidence

AK066766

Protein Evidence

A0A0P0YD24

Literature

PMID: 30124964

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

February 28, 2020

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen (GO:0016702)

Functional domain (InterPro)

Carotenoid oxygenase (IPR004294)

Full-length cDNA

J013088L06 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0640600-01)

Others

Oryzabase (18342)

Transcript

2011 bp

>Os12t0640600-01 Carotenoid-cleavage dioxygenase
GTGCAGTAGTGTAAGCAGAAGCAGACGCACCAAAAGAGACGAACACTACTACTAGTATAG
TATTCCCCATTGGATTCCATCCGCCGGCCGGCCTGCTGCCTGCCTGCCATTGATAGATTC
CATCGTCGTCGTAGGATAGAGAGTACTAGTTTGCAATTCAATTCAATCCCCCATACCCAT
AGGCCATAGGATAGGAGTATGGGAGGCGGCGATGGCGATGAGGTGCTGCTGCTGCCGGAG
CCGCGCCCTCGCAGGGGCCTCGCCTCCTGGGCGCTCGATCTGCTGGAGCGCGCCGCCGTC
CGCCTCGGCCACGACGCCTCCAAGCCGCTCTACTGGCTCTCCGGCAACTTCGCCCCCGTC
CACCACGAGACCCCGCCGGCCCCGGCCCTCCCCGTCCGCGGCCACCTCCCCGAGTGCTTG
AATGGAGAATTTGTCAGGGTAGGACCCAATCCAAAGTTTGTCCCTGTCGCTGGCTATCAT
TGGTTTGATGGAGATGGAATGATCCATGCGATGCGTATCAAAGATGGGAAAGCTACCTAT
GTGTCGAGATATGTGAAGACTTCTCGTCTCAAGCAAGAAGAGTATTTTGGTGGAGCAAAG
TTTATGAAGATTGGAGACCTGAAGGGATTTTATGGATTGTTTATGGTCCAAATGCAACAA
CTCCGGAAAAAACTCAAAGTATTGGATTTTACATATGGACATGGGACAGCTAATACTGCA
CTTATCTATCACCATGGTAAACTTATGGCCCTGTCAGAGGCAGATAAGCCCTATGTTGTT
AAGGTCCTTGAAGATGGAGACTTGCAAACTCTTGGATTGTTGGATTACGACAAACGGTTG
AAACACTCTTTCACTGCTCATCCAAAGGTCGATCCATTTACAGACGAAATGTTCGCTTTT
GGATATTCGCATGAACCTCCTTACTGTACATACCGGGTCATTACCAAGGATGGAGCCATG
CTTGATCCTGTGCCAATAACAATTCCAGAATCTGTAATGATGCACGACTTTGCCATTACA
GAGAATTATTCTATTTTCATGGACCTTCCTCTGTTGTTCCGACCAAAGGAAATGGTGAAG
AATGGTGAGTTTATCTACAAGTTTGATCCTACAAAGAAAGCTCGTTTTGGTATACTCCAA
CGTTATGAAAAGGATGACACAAACATCAGATGGTTTGAACTTCCCAACTGCTTCATATTC
CACAATGCTAATGCTTGGGAAGAGGGTGACGAAGTTATCCTAATTACCTGCCGCTTGGAG
AATCCTGACTTGGACAAGGTGAACGGTTACCAAAGCGACAATCTCGAGAACTTTGGGAAT
GAGCTGTATGAGATGAGATTCAACATGAAAACCGGTGCTGCTTCACAAAAGCAACTATCT
GTTTCTGCTGTAGATTTTCCTCGAATTAATGAGAGCTACACTGGCAGaaagcagcggtat
gtgtattgcgctattctaaacagcatagcgaaggtagcaggcattataaaatttgatcta
catgctgaaccggagatcagtggcatgaaacaacttgaagtggggggaaatgtgagagga
atatttgacttgggacctggtagattcgggtccgaggcaatttttgtgcctagggaaccc
ggtgtatctggagaagaagatgatggttatttgatATTCTTTGTCCACGACGAGAATACA
GGGAAATCTGAAGTCAATGTGATTGATGCAAAGACAATGTCTGCTGATCCGGTGGCAGTT
GTTGAGCTACCAAGCCGAGTTCCCTACGGATTCCATGCTTTCTTTATAAACGAGGAACAA
CTGGCAAAACAATCAGCGTGACAAGTGACAGCGGACTGCATACATCCTACAGTAACTTGT
TATATTTTAGTCGGAGGGAAATGATATATACATATGAATGTACATGTGTATCCTCTTACT
CGGGGAAATAATTGGCTTAAGGTACATATATGTTTAACTCGAATTGAACAATTACTCCTA
TATTAATTACTTATTAAGGGAGGGTTATTAT

CDS

1623 bp

>Os12t0640600-01 Carotenoid-cleavage dioxygenase
ATGGGAGGCGGCGATGGCGATGAGGTGCTGCTGCTGCCGGAGCCGCGCCCTCGCAGGGGC
CTCGCCTCCTGGGCGCTCGATCTGCTGGAGCGCGCCGCCGTCCGCCTCGGCCACGACGCC
TCCAAGCCGCTCTACTGGCTCTCCGGCAACTTCGCCCCCGTCCACCACGAGACCCCGCCG
GCCCCGGCCCTCCCCGTCCGCGGCCACCTCCCCGAGTGCTTGAATGGAGAATTTGTCAGG
GTAGGACCCAATCCAAAGTTTGTCCCTGTCGCTGGCTATCATTGGTTTGATGGAGATGGA
ATGATCCATGCGATGCGTATCAAAGATGGGAAAGCTACCTATGTGTCGAGATATGTGAAG
ACTTCTCGTCTCAAGCAAGAAGAGTATTTTGGTGGAGCAAAGTTTATGAAGATTGGAGAC
CTGAAGGGATTTTATGGATTGTTTATGGTCCAAATGCAACAACTCCGGAAAAAACTCAAA
GTATTGGATTTTACATATGGACATGGGACAGCTAATACTGCACTTATCTATCACCATGGT
AAACTTATGGCCCTGTCAGAGGCAGATAAGCCCTATGTTGTTAAGGTCCTTGAAGATGGA
GACTTGCAAACTCTTGGATTGTTGGATTACGACAAACGGTTGAAACACTCTTTCACTGCT
CATCCAAAGGTCGATCCATTTACAGACGAAATGTTCGCTTTTGGATATTCGCATGAACCT
CCTTACTGTACATACCGGGTCATTACCAAGGATGGAGCCATGCTTGATCCTGTGCCAATA
ACAATTCCAGAATCTGTAATGATGCACGACTTTGCCATTACAGAGAATTATTCTATTTTC
ATGGACCTTCCTCTGTTGTTCCGACCAAAGGAAATGGTGAAGAATGGTGAGTTTATCTAC
AAGTTTGATCCTACAAAGAAAGCTCGTTTTGGTATACTCCAACGTTATGAAAAGGATGAC
ACAAACATCAGATGGTTTGAACTTCCCAACTGCTTCATATTCCACAATGCTAATGCTTGG
GAAGAGGGTGACGAAGTTATCCTAATTACCTGCCGCTTGGAGAATCCTGACTTGGACAAG
GTGAACGGTTACCAAAGCGACAATCTCGAGAACTTTGGGAATGAGCTGTATGAGATGAGA
TTCAACATGAAAACCGGTGCTGCTTCACAAAAGCAACTATCTGTTTCTGCTGTAGATTTT
CCTCGAATTAATGAGAGCTACACTGGCAGaaagcagcggtatgtgtattgcgctattcta
aacagcatagcgaaggtagcaggcattataaaatttgatctacatgctgaaccggagatc
agtggcatgaaacaacttgaagtggggggaaatgtgagaggaatatttgacttgggacct
ggtagattcgggtccgaggcaatttttgtgcctagggaacccggtgtatctggagaagaa
gatgatggttatttgatATTCTTTGTCCACGACGAGAATACAGGGAAATCTGAAGTCAAT
GTGATTGATGCAAAGACAATGTCTGCTGATCCGGTGGCAGTTGTTGAGCTACCAAGCCGA
GTTCCCTACGGATTCCATGCTTTCTTTATAAACGAGGAACAACTGGCAAAACAATCAGCG
TGA

Protein

541 aa

>Os12t0640600-01 Carotenoid-cleavage dioxygenase
MGGGDGDEVLLLPEPRPRRGLASWALDLLERAAVRLGHDASKPLYWLSGNFAPVHHETPP
APALPVRGHLPECLNGEFVRVGPNPKFVPVAGYHWFDGDGMIHAMRIKDGKATYVSRYVK
TSRLKQEEYFGGAKFMKIGDLKGFYGLFMVQMQQLRKKLKVLDFTYGHGTANTALIYHHG
KLMALSEADKPYVVKVLEDGDLQTLGLLDYDKRLKHSFTAHPKVDPFTDEMFAFGYSHEP
PYCTYRVITKDGAMLDPVPITIPESVMMHDFAITENYSIFMDLPLLFRPKEMVKNGEFIY
KFDPTKKARFGILQRYEKDDTNIRWFELPNCFIFHNANAWEEGDEVILITCRLENPDLDK
VNGYQSDNLENFGNELYEMRFNMKTGAASQKQLSVSAVDFPRINESYTGRKQRYVYCAIL
NSIAKVAGIIKFDLHAEPEISGMKQLEVGGNVRGIFDLGPGRFGSEAIFVPREPGVSGEE
DDGYLIFFVHDENTGKSEVNVIDAKTMSADPVAVVELPSRVPYGFHAFFINEEQLAKQSA
*

5'UTR

chr12:27464832..27465029 (+ strand) : 198 bp

CDS

chr12:27465030..27465242 (+ strand) : 213 bp

chr12:27466128..27466198 (+ strand) : 71 bp

chr12:27466524..27466538 (+ strand) : 15 bp

chr12:27467162..27467273 (+ strand) : 112 bp

chr12:27468203..27468302 (+ strand) : 100 bp

chr12:27468442..27468504 (+ strand) : 63 bp

chr12:27469071..27469181 (+ strand) : 111 bp

chr12:27469268..27469452 (+ strand) : 185 bp

chr12:27469865..27470003 (+ strand) : 139 bp

chr12:27470237..27470354 (+ strand) : 118 bp

chr12:27470431..27470532 (+ strand) : 102 bp

chr12:27470767..27471021 (+ strand) : 255 bp

chr12:27471178..27471289 (+ strand) : 112 bp

chr12:27471451..27471477 (+ strand) : 27 bp

3'UTR

chr12:27471478..27471667 (+ strand) : 190 bp

FASTA

>Os12t0640600-01 class=Sequence position=chr12:27464832..27471667 (+ strand)
GTGCAGTAGT GTAAGCAGAA GCAGACGCAC CAAAAGAGAC GAACACTACT ACTAGTATAG TATTCCCCAT TGGATTCCAT
CCGCCGGCCG GCCTGCTGCC TGCCTGCCAT TGATAGATTC CATCGTCGTC GTAGGATAGA GAGTACTAGT TTGCAATTCA
ATTCAATCCC CCATACCCAT AGGCCATAGG ATAGGAGTAT GGGAGGCGGC GATGGCGATG AGGTGCTGCT GCTGCCGGAG
CCGCGCCCTC GCAGGGGCCT CGCCTCCTGG GCGCTCGATC TGCTGGAGCG CGCCGCCGTC CGCCTCGGCC ACGACGCCTC
CAAGCCGCTC TACTGGCTCT CCGGCAACTT CGCCCCCGTC CACCACGAGA CCCCGCCGGC CCCGGCCCTC CCCGTCCGCG
GCCACCTCCC CGTACACCTC CCCTATCCTA TCCTCCTCCT TTTCTTTTCA TTCATAAACA CTACTACTTC CATCTGCTTG
CCTTGCCGAG atatttaacc atttgccaca tttagatgtg acaattaact ttttgccatt agactcacat gtcatagaca
tatgtggact cacatgtcat ataggggtgg caaatagtta tttgccaaat ctctaacagt ggcaaatagt taaaagcccc
TGCCTTGTCT GCTTCTTATT ATGTAGCACT CCACTCTGAA AGAAACGAAA AAAAGGAGGA GAAGAAATTT CTCCCCCTTT
CTTCCTCCTG TACTGCCCAT AGCTCAAATC TTTGTCGCCT CAACAAAAGA GATTAAAATA CACTCCAGAT TGTCCTTTCC
AATGGTTTGT TTGGGTATCA TATATACGAT GAACAGTCTC ACTAGTCAAC GCCAATTAAT GCACCACACC ACATACTAGT
ACTAGTCAAC GCCAATTTAT GTACACTACC AACACTAATT TTTTCCATCT CTCCTTCTCA TCACTATGCA TGTAGTAACA
CTCAAACTGA CATCTTCCAT TACCCCTGCT CTCCCCTTCT CTTCTCCTGT ACCCTATTCA TTCATTCATT CATTCATTCA
TGTTTTTTCT TCGCCTATTC ATCTCTGCAC TAAGATGACA CCTAGGAACC ATTTTGACCA CCAAAATCTC TTTATCAAAA
ATTATGCAAC AACAACCTCT ATGGTGGAAG CGATCAAACA TTCTGTCGTT CACAATGATA ACTGTGTTTC AACACTACCT
CTACAAACTG TTCATTAGGC ACTCATCAAG ATCATGTATG CGGCCTCCTC TTTTTTGCTT TCACCTTCTC ACTGACCCGT
CTTTGGTTTT CCACAGGAGT GCTTGAATGG AGAATTTGTC AGGGTAGGAC CCAATCCAAA GTTTGTCCCT GTCGCTGGCT
ATCATTGGTA TTAACCCCTC CCTCTCTCTC TCTCTCTCTC TCTCTCTCTC TCTAGCTTCA TCACAATTTT CCTTTCTCTT
AAAAAGACAT TATTGTAAGG ATTGCCATCT TGTTTTCATT AGTGCGTCCA AACAAAAACA AACTGTACAG ATTTTAAATT
GTCATCCATA TGGGTTTGCA TTTATGCCTC TGCTTTGATG CACATATAAG GGACAATTGT ACTCTATTTT CTAAAACACA
AAATACATAT CCTCATACCT GTTGGCCTGT TGCTTCCAAT ATCTGTGCAT AACGTGTTTA ATTGATTTCA TATTCTCTGT
TTGTTTCCAC AGGTTTGATG GAGATGGGTA TGTCATATTA GCCTCTCTGT GGTCAGATGC ATATCCTTAA CGGCATACAT
ATCTGCTTCT CTCTAGCTAA TACATTTAAT TCCCAGATAA TTATTGCATT ATCCACTTCT TTAGCAGTTG ACTAAGGTCT
TACTGTCTGC CCCTAAATTG GAGTTTTTTC TTTCCAATAA GAGTCTACAT GATAAAATCT ATTGTTCCAT GTAGTGTTTC
TTAGAATTTA ATTTTCGCAT GTATATTGTA GTCCATTGTT TAAAGCAAAT TTTTTTTCCT CTACTGTTTA AAGATAGTGT
CAGACTGACA GATTTGCACA CAGAACATTC TGATCTTCAG AGCAGATATG GCAAAATCGT TCTTTGATGC AGATCTTACA
CGTTATATAT CTTCATGGTT TCATGGGCAT ATTTGACGCT ATGTATTGCC ATTTTGCAGC ACTTTTAGTA CTTCTAAATT
TTAATGTTTT GGTGACATAT TAACAGTACC TCATAGTTTT ATAACATATT TGCAAACATG ATCAAAATGT GTTCTTTTTT
TTATTTTCTG GAAGTGAAAA TAGGAGTTTA ACAAGGGCAC GTGCGTGGAA AAATAAGATT TCAAAATGTG CATAACTTTG
TTTCTTACAG AATGATCCAT GCGATGCGTA TCAAAGATGG GAAAGCTACC TATGTGTCGA GATATGTGAA GACTTCTCGT
CTCAAGCAAG AAGAGTATTT TGGTGGAGCA AAGTTTATGA AGGTAACTTC AATTGTTTGA TTAGACATTC TCATGTCTTT
GCAATTAATC GATTGTTACT GTAGTATTTT CTTGACTACA GCTCCAAAAT GTATTCTGTT TAGCTTGTTG GCGAGTGTGA
CTTTTCTAGT TTGTACATAA GTTTCTCAAT TTAACTTAAT CTTCAGATTT TTTGTAATCA GGCTAtgctt agatccaggg
gtgaaaagtt ttggcgtcac attggatata cggacacaca tttgaagtat taaacgtaga ctaataacaa aacaaattac
agattccgcc tgtaaactgc aagacgaatt tattatgcct aattaatccg tcattagcaa atgtttactc tagcactaca
ttgtcaaatc atggagcaat taggcttaaa agattcgtct cgcaatttac acgcaatctg tgtaattagt tttttatttt
gtctatattt aatactccat gcatgtgtcc aaacattcga tgtgacaggg tgaaaagttt ttgcatggga actaaacagg
gccTCAGTTT ACTGCTGCTT CTTAGCGACA TACCTTACCC AGCATGATTT TCTTCAGCAT ATTTTTGGTT CTCGGTTTTC
TCACAGATCT CTCTGTGCTT GCATGTTGGG TTGCAGTGTC GAATTTTTGT TGATTTCATA TGCATATCAG CTTTGAACTT
GTCGTATAGT CATAGGGACC TCACTTTATT TATGTCCTCT TAGTTTCTTT GCTTCTACAC TAACTGCCTG ACTATATAGT
TGACCTACGG TGACATCAAT GTAACTTCAT GATCATCCTT AAATGTACCA TTAGAAAATT CAAGTCCTGT TGATAACTAC
TTCTAAATCC TAACTCTCCA GCTCTTTTAT GGCCATTGAC AATCAGTAAT ACATGCATGT GCTTTTTTTA CCTGATTCTT
ACATTTTACA GATTGGAGAC CTGAAGGGAT TTTATGGATT GTTTATGGTC CAAATGCAAC AACTCCGGAA AAAACTCAAA
GTATTGGATT TTACATATGG ACATGGGACA GGTTATTTTT ATCTTACGCA GAACCTATTC AAATATCATG TTTAAATGCA
GGACAATTTT CTGCACTGCA TGTTGTCATT TTTTTTCACG ACCATTTGGT GTAACACCAT TTTATTGATT TGGTGACTTT
GTTTTTTCAG CTAATACTGC ACTTATCTAT CACCATGGTA AACTTATGGC CCTGTCAGAG GCAGATAAGC CCTGTAAGTT
CTCATCCCAT AATGGTAATG GCTAGTTGGG AAAGTTGTGA CAAAACATGG ATATAGCTAG ACCCAGTGTG GTATTTTCAC
ATCTAGCTTA AAACGTTAAT ACTACATTTT TCTATAGCCA CTACACATGC CATTGGAAAT TCAACAGCAC GATCCTTTAT
TTTTGACAAA CGCGACCAGG TTGCCAGCTT ACTTTTGTGT AAATGGAAAA TGGCAAAATC CCCCCCCCCC CCAAAGCTAG
GAGAAAATCT ACCTGTTTCA TCTCCAATAT CATAAGAATA GCAAAGGAAT CAATCACTTG AGATTTTTAC AACAGTACAA
AGCATTTCCA AATGATTATT GGCTTATGAA TATTGCATTG CACTATGCAT GATTATCGTG TCAGACTATC ACAATATGTT
ATATGTGGTC GATTTCATAT ACCATCATAG GAAATTTATT TTGTTTCTCA TGAACAGTTC TGCATGCCAG CTGATTTTTA
TTTTAGATTT AGATCTATGT AAATTGTAAA ATAAATATTT TTGCAACTGT GAAACTCTGG TTTCTGCGTT CGTTTTCAGA
TGTTGTTAAG GTCCTTGAAG ATGGAGACTT GCAAACTCTT GGATTGTTGG ATTACGACAA ACGGTTGAAA CACTCTTTCA
CTGCTCATCC AAAGGTCGAT CCATTTACAG GTACACAACA GTAACTCATG TTATTTCTTG CTTTCCCTAT TGTTTATCGT
AATTGTGTTA AAAGGTTTTA TTTACCGGTC TTTCAGACGA AATGTTCGCT TTTGGATATT CGCATGAACC TCCTTACTGT
ACATACCGGG TCATTACCAA GGATGGAGCC ATGCTTGATC CTGTGCCAAT AACAATTCCA GAATCTGTAA TGATGCACGA
CTTTGCCATT ACAGAGAATT ATTCTATTTT CATGGACCTT CCTCTGTTGT TCCGACCAAA GGTAAGTGGT GTTTTTGCTT
GTCTAGCAAT TTGTGGCCAA GGTCATTGAC AGACTTTTTT TTTCTGCCCC TTATTTTACT ACGTCAATAA ACAATCATAG
TACGGTTTGC AGTGCTTTAT TCTAACCGAA GAACATTGAC CAAAACATAG GATACTGTTT CAGCATGTAC AGATTGTTAC
TTGTTAATAC ACATACCTTT ATAGTGGTTT GCTGGTTTTA GAATCCTAAG GGAACATCCG TTGTTTTTTC TTAAGATTTC
CATGATGAAT ACTCCATATG TATGCATTCC GTTCAAGAAT ACCTAGTCAA TATATGCTGC AGAGGGTAGC ACTTGTGTTC
ATTGAAGCAT TTGATAAATG ATATCAAAAC CTCTTCATAA TTTGACTCTT GCCCTGTCCC ATCATTTTAT AAGGAAATGG
TGAAGAATGG TGAGTTTATC TACAAGTTTG ATCCTACAAA GAAAGCTCGT TTTGGTATAC TCCAACGTTA TGAAAAGGAT
GACACAAACA TCAGATGGTT TGAACTTCCC AACTGCTTCA TATTCCACAA TGGTATGCCA TTGGTAACCT TCTTGAACTT
CACATGTACA ACATTTTGTA CATTGGACAT GATGATGAAT AACTGTAACG ACAAATTTGT CTTGGCCTTC CAAAGGGTGC
TTTGCTAGGA ATGTGAGAAC ATAAAACCAA AAACATAGAG TTAAAAAAAG GGAACTAGAA GATATCAGTA TTTCATCTCA
TGCTGTTCTA CGTTATCTGC TCATTAGAAT TCTCTCTTGT TACAGCTAAT GCTTGGGAAG AGGGTGACGA AGTTATCCTA
ATTACCTGCC GCTTGGAGAA TCCTGACTTG GACAAGGTGA ACGGTTACCA AAGCGACAAT CTCGAGAACT TTGGGAATGA
GCTGTATGTA CCTACAATTC AGTCGCCATT TAAATTCCAA GAAATGAAAT GCTTGACCCA GTGTTATATA TATACTTAGG
TATGAGATGA GATTCAACAT GAAAACCGGT GCTGCTTCAC AAAAGCAACT ATCTGTTTCT GCTGTAGATT TTCCTCGAAT
TAATGAGAGC TACACTGGCA GGTAACTTTT AGTGGAAGTC TCAACTTCAA TAAGTAATGA TTCTTCTCTA GGAAATCATG
GGCAACCTGT TCATATCAGC TGCATTGTTC ATTTCTGTTT TGTCGATGAT TTGATGATGG CCATATATAT ATCAAGCACT
ATATACGAAA GTCAGCATCA TAGAGAACTT AGACTTGGCT GCTTCCTGAA TCACttgact cacatgcttc taacgtgcaa
atttggtgaa aacagaaagc agcggtatgt gtattgcgct attctaaaca gcatagcgaa ggtagcaggc attataaaat
ttgatctaca tgctgaaccg gagatcagtg gcatgaaaca acttgaagtg gggggaaatg tgagaggaat atttgacttg
ggacctggta gattcgggtc cgaggcaatt tttgtgccta gggaacccgg tgtatctgga gaagaagatg atggttattt
gatATTCTTT GTCCACGACG AGAATACAGG GTACTCATTA TCTTTTCCTT CCCTACCAAT TAACTGCTCC ATGCGTGTAT
GTTGTATGTT AGTTGCTGTA GTCTGATACA AAACATGCAT GCCCATCTGT TGCTCTCCAA TTTTTATAGT TTACACTATC
AAATTTGTTT TGTGTCGTTG GTGTAGGAAA TCTGAAGTCA ATGTGATTGA TGCAAAGACA ATGTCTGCTG ATCCGGTGGC
AGTTGTTGAG CTACCAAGCC GAGTTCCCTA CGGATTCCAT GCTTTCTTTA TAAACGAGGT ACGAAAACCA TTCGAATTGT
ATGTACCTAT GTAGATATAT ATAGAGAAGA CTTTAAATTG TTTTGAGCTC ATACACTTTC CGTTTTCTCT GGTCTTCAAT
TTGGGCGATT CTATGTGAAT ATGAATATGA TGTGATATGG TCAATTTGCC CTTTGACAGG AACAACTGGC AAAACAATCA
GCGTGACAAG TGACAGCGGA CTGCATACAT CCTACAGTAA CTTGTTATAT TTTAGTCGGA GGGAAATGAT ATATACATAT
GAATGTACAT GTGTATCCTC TTACTCGGGG AAATAATTGG CTTAAGGTAC ATATATGTTT AACTCGAATT GAACAATTAC
TCCTATATTA ATTACTTATT AAGGGAGGGT TATTAT

Locus: Os12g0640600

Loading...

Locus: Os12g0640600

Loading...