Os12t0641400-01

Locus

Os12g0641400

Description

Similar to Sucrose transporter.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SUT2

CGSNL Gene Name

SUCROSE TRANSPORTER 2

Oryzabase Gene Symbol Synonym(s)

OsSUT2(t), SUT2M, OsSUT2, OsSUT2M, OsSUT5

Oryzabase Gene Name Synonym(s)

sucrose transporter2(t), Sucrose transport protein 2, Sucrose permease 2 ; Sucrose-proton symporter 2, Sucrose transporter 2, Sucrose transporter-2, SUC4-like protein, sucrose transporter 2M

Transcript Evidence

AK067030 (DDBJ, Best hit)

Protein Evidence

Q0ILJ3 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Major facilitator superfamily domain, general substrate transporter (IPR016196)

Full-length cDNA

J013093C04 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0641400-01)

RiceXPro (AK067030)

Others

Oryzabase (2208)

KEGG (Os12t0641400-01)

Transcript

1985 bp

>Os12t0641400-01 Similar to Sucrose transporter.
TCTTCTGAACTAACCCAAAGATCAGGTCGGAGGCGGAGGCAAACACGAGAAGAAGATGCC
GCGGCGGCCTAGCGGCGGCGGCGGCGGCGCTGGTCCCGCGGCGGCCGCGGTGCGCAAGGT
CCCCCTGCGGAAGCTTCTGCGTGCGGCGTCGGTGGCGTGCGGCGTGCAGTTCGGGTGGGC
GCTGCAGCTCTCCCTGCTGACCCCCTACGTCCAGGAGCTCGGCATCCCGCACGCCTTCGC
CAGCCTCGTCTGGCTCTGCGGCCCCCTCTCCGGCCTCCTCGTCCAGCCCCTCGTCGGCCA
CCTCTCCGACCGCATCGCCCCCGCCGCCGCCCCTTCATCGCCGCCGGCGCCGCTTCCATC
GCTGCCGCAGTTCTCACCGTCGGATTCTCCGCCGACCTCGGCCGAATCTTCGGCGATTCC
ATCACCCCGGGCTCCACCCGCCTCGGCGCCATCATCGTCTACCTCGTCGGCTTCTGGCTC
CTCGACGTCGGCAACAACGCTACACAGGGACCCTGCAGGGCCTTCCTCGCCGACCTCACC
GAGAATGACCCAAGGAGGACTCGGATAGCTAATGCTTACTTCTCATTGTTCATGGCCCTG
GGAAACATACTTGGATATGCCACTGGAGCATACAGTGGCTGGTACAAGATATTCCCGTTC
ACCGTTACTCCATCATGTAGCATCAGCTGTGCCAACCTCAAGTCTGCCTTTCTACTTGAT
ATTATCATTTTGGTGGTCACTACATGCATCACTGTAGCATCAGTGCAAGAGCCTCAATCC
TTTGGAAGTGATGAAGCAGATCACCCTAGCACAGAACAGGAAGCTTTCCTCTGGGAACTT
TTTGGATCATTCCGGTACTTTACATTACCGGTTTGGATGGTTTTGATTGTTACTGCCCTC
ACATGGATTGGATGGTTTCCATTTATCCTCTTTGATACCGATTGGATGGGTCGAGAGATC
TATCGTGGAAGTCCAGATGATCCAAGTATAACTCAGAGCTATCATGATGGTGTGAGAATG
GGTTCTTTTGGTCTGATGCTGAACTCGGTCCTTCTTGGATTCACTTCTATTGTACTAGAG
AAGTTATGTCGGAAGTGGGGAGCTGGACTGGTGTGGGGTGTCTCCAATATCCTAATGGCA
TTGTGCTTTGTGGCAATGCTTGTAATAACATATGTGGCAAAGAATATGGATTATCCACCT
AGTGGAGTACCACCAACCGGCATTGTCATTGCTTCCCTGGTAGTTTTTACAATTTTAGGA
GCGCCCCTGGCGATCACGTACAGTATACCATATGCAATGGCTGCTAGTCGGGTTGAAAAT
CTGGGACTTGGCCAAGGTCTAGCAATGGGCATTCTTAATTTGGCTATTGTCATACCACAG
GTTATTGTGTCACTGGGTAGCGGGCCCTGGGACCAACTGTTTGGTGGTGGCAATGCACCA
GCCTTTGCAGTGGCTGCTGCTGCATCTTTTATCGGTGGGCTGGTGGCTATTCTGGGCCTT
CCACGAGCCCGCATTGCATCAAGGAGGAGAGGTCACCGATAAGAATATTGCTACATATAA
ATTGTCGGCCATTCTTTGCAATTCGACTCATAAGAGGCACTCGGAACGCTATGCAGTGCA
TGGGGGAATTGTATATTATCTCCGAATCAAGAAGGGGATAATGCTTGCTTTCTCCATGAG
CTATTTTTGCCTTTTTCATGCCGGATCATCATATGCTGTCGTACATTGGATGATCTTATG
CTGTTGTACATTGGATGTTGGTCATTTGTAGAGATACTAGTGAATAAAAGTTGCAGGAGT
TGGTTCACTCGAGAAAATTCTGGTCAGTATGTCGTCCATCTGCTGCACGACAGCAGTTAG
GAGCCGAATAGCATGTCCATGGGTTTTCATCAAATGTTGTATCATCATTTGTTTTTTGAT
ACGTTCAGACGGCTTCAGTGCTGTGTGAATATATATGTATGGAATATATCGAGAAAATGT
TGTTG

CDS

513 bp

>Os12t0641400-01 Similar to Sucrose transporter.
ATGCCGCGGCGGCCTAGCGGCGGCGGCGGCGGCGCTGGTCCCGCGGCGGCCGCGGTGCGC
AAGGTCCCCCTGCGGAAGCTTCTGCGTGCGGCGTCGGTGGCGTGCGGCGTGCAGTTCGGG
TGGGCGCTGCAGCTCTCCCTGCTGACCCCCTACGTCCAGGAGCTCGGCATCCCGCACGCC
TTCGCCAGCCTCGTCTGGCTCTGCGGCCCCCTCTCCGGCCTCCTCGTCCAGCCCCTCGTC
GGCCACCTCTCCGACCGCATCGCCCCCGCCGCCGCCCCTTCATCGCCGCCGGCGCCGCTT
CCATCGCTGCCGCAGTTCTCACCGTCGGATTCTCCGCCGACCTCGGCCGAATCTTCGGCG
ATTCCATCACCCCGGGCTCCACCCGCCTCGGCGCCATCATCGTCTACCTCGTCGGCTTCT
GGCTCCTCGACGTCGGCAACAACGCTACACAGGGACCCTGCAGGGCCTTCCTCGCCGACC
TCACCGAGAATGACCCAAGGAGGACTCGGATAG

Protein

171 aa

>Os12t0641400-01 Similar to Sucrose transporter.
MPRRPSGGGGGAGPAAAAVRKVPLRKLLRAASVACGVQFGWALQLSLLTPYVQELGIPHA
FASLVWLCGPLSGLLVQPLVGHLSDRIAPAAAPSSPPAPLPSLPQFSPSDSPPTSAESSA
IPSPRAPPASAPSSSTSSASGSSTSATTLHRDPAGPSSPTSPRMTQGGLG*

5'UTR

chr12:27518031..27518085 (- strand) : 55 bp

CDS

chr12:27517758..27518030 (- strand) : 273 bp

chr12:27517526..27517738 (- strand) : 213 bp

chr12:27516300..27516326 (- strand) : 27 bp

3'UTR

chr12:27515596..27516299 (- strand) : 704 bp

chr12:27515451..27515514 (- strand) : 64 bp

chr12:27515336..27515379 (- strand) : 44 bp

chr12:27513968..27514572 (- strand) : 605 bp

FASTA

>Os12t0641400-01 class=Sequence position=chr12:27513968..27518085 (- strand)
TCTTCTGAAC TAACCCAAAG ATCAGGTCGG AGGCGGAGGC AAACACGAGA AGAAGATGCC GCGGCGGCCT AGCGGCGGCG
GCGGCGGCGC TGGTCCCGCG GCGGCCGCGG TGCGCAAGGT CCCCCTGCGG AAGCTTCTGC GTGCGGCGTC GGTGGCGTGC
GGCGTGCAGT TCGGGTGGGC GCTGCAGCTC TCCCTGCTGA CCCCCTACGT CCAGGAGCTC GGCATCCCGC ACGCCTTCGC
CAGCCTCGTC TGGCTCTGCG GCCCCCTCTC CGGCCTCCTC GTCCAGCCCC TCGTCGGCCA CCTCTCCGAC CGCATCGCCC
CCGCCGCCTC CCCCCTCGGC CGCCGCCGCC CCTTCATCGC CGCCGGCGCC GCTTCCATCG CTGCCGCAGT TCTCACCGTC
GGATTCTCCG CCGACCTCGG CCGAATCTTC GGCGATTCCA TCACCCCGGG CTCCACCCGC CTCGGCGCCA TCATCGTCTA
CCTCGTCGGC TTCTGGCTCC TCGACGTCGG CAACAACGCT ACACAGGGAC CCTGCAGGGC CTTCCTCGCC GACCTCACCG
GTATCTATCT ACCCTACCTA CCATCGATTG CTTGATTGAT TGCTAGCTTG CTTGCTTCCC AACTTTCGCA TCGAACAGCC
AAGAGGAATT GGAATTGGAC CTCGCTTCCG CCACAAGCCA CACCTGCTCA TCTTTTCGAT TCCGTCCAAT TGCGAAACGT
AGGACCAAAC TTCAAAACAA TTTCCTCTTT TTCTTTTTTT TTTCTTATGT GGCTGTATGT GTGGCTGTGT GTGGACACAA
CACAACAGCA GCCTGCCTCT GCGTATCGCT TTCCCCTTTA GCCTGCCTGC CTGAGATTCT TGCTCCGATG GATGCTGGTC
GGCGTAACTC ATTTTGCTTG TCTCCCTAAA AATTATATTA TATATTTCCT CTTCATTTGT TTATTTATTT TACGGCCATG
GTTTTTTGTT TGCCCTGCCA GCTGGCCTAT TATTAGCATC AGGGTTAGGC GAGCTGGACA ACACGAACCA CAAAACGACA
TGACAACTCA TTACACTGCA TATATTTGAA TAATTAGGGT TGGTACAAAT GTCGCACCAA TTGTTTTTTT TTCATTTCTT
CCTTGTAGTT TTTTTTTTCA TTTCTTCCTT GTTTACACGG AGTATTCGAT GGTTGTGGGA GGGGGAGGTC AAGGGATCGC
TTTCTGACTG AGATAGGAAT ATAGAAAGGA AGATATTTGA GTGTTACAGT ACCCCTGTAA GTTTGGAATC ATAGGAGGAG
AAAGAGCATC TTTTGTCAGC AGACAGGGCT ATTGTCTGAG GGGCCCTGGT TAAATAATTG TAAGGCTGGC AGTGGTTTGT
AGCTGTGGTC TTTGTTATGC CTTTGCATTC TATGGGAAAC ACCTGATGCA AACATTACAT TCAGAAGGCA TGATTGTGCT
TTTTGTCATG GAAATGCTGG AGTTCCACGG TAAATTGGTG ATAAAATTGA TATGATTGTA ATATTACTCC ATGATCTTCT
GTTTAGGCAG TCAAATTCAG CTGGCACGAT CTCCATTATC CAATGCATGT GGATATGTGC ATACAAGAGC TTTTCAGATA
TTCTTAACTT GTAGTTGCAC ATGCCTGTCC TCAAATTTTT CCCAGTAATG TTTACACCAA TAACCCATCT GTGCAATGTA
ACGTGTTCGA AAGGCATCGT AATTGCATTA GCATTTTTCC ACACCTCGTA AATGCTCATT CTGATCCTTT CTATTTCAGA
GAATGACCCA AGGAGGACTC GGATAGCTAA TGCTTACTTC TCATTGTTCA TGGCCCTGGG AAACATACTT GGATATGCCA
CTGGAGCATA CAGTGGCTGG TACAAGATAT TCCCGTTCAC CGTTACTCCA TCATGTAGCA TCAGCTGTGC CAACCTCAAG
TCTGCCTTTC TACTTGATAT TATCATTTTG GTGGTCACTA CATGCATCAC TGTAGCATCA GTGCAAGAGC CTCAATCCTT
TGGAAGTGAT GAAGCAGATC ACCCTAGCAC AGAACAGGAA GCTTTCCTCT GGGAACTTTT TGGATCATTC CGGTACTTTA
CATTACCGGT TTGGATGGTT TTGATTGTTA CTGCCCTCAC ATGGATTGGA TGGTTTCCAT TTATCCTCTT TGATACCGAT
TGGATGGGTC GAGAGATCTA TCGTGGAAGT CCAGATGATC CAAGTATAAC TCAGAGCTAT CATGATGGTG TGAGAATGGG
TTCTTTTGGT CTGATGCTGA ACTCGGTCCT TCTTGGATTC ACTTCTATTG TACTAGAGAA GTTATGTCGG AAGTGGGGAG
CTGGACTGGT GTGGGGTGTC TCCAATATCC TAATGGCATT GTGCTTTGTG GCAATGCTTG TAATAACATA TGTGGCAAAG
AATATGGATT ATCCACCTAG TGGAGTACCA CCAACCGGCA TTGTCATTGC TTCCCTGGTA GTTTTTACAA TTTTAGGAGC
GCCCCTGGCG GTGAGTAACA ATTTTTTCCC TCCAGAGTTT CTTCAAGTTC TCACTGGTGT ATGGTATCCT TATTAATTCT
TGTTATTGCA GATCACGTAC AGTATACCAT ATGCAATGGC TGCTAGTCGG GTTGAAAATC TGGGACTTGG CCAAGGTACT
GTTCCTTTTG AGTCAATGCT ATCATTTTGG GTTCCTGTAC TTAGGAAGTC TTTGTTTCAC ATGCAGGTCT AGCAATGGGC
ATTCTTAATT TGGCTATTGT CATACCACAG GTATGTATTT CTTGCCTTTT TTTCTCTTTG TTTTAGAGTT TGATTCGTTC
AAACATATGA CTGTAACACA GTACAATTAT GAATATTGAC ATGATTGCTG TATCCTAAAA TAACCTGTTG ATGGTGGAAA
CTTACTTAAT TCATGGCTCA ACCACAGTTA TCAGACACAA TTTAAGAAAT GGTTTAATGG TTAATTGTAA GCTATGACCT
GCCGTCGACC ATGTCAAAAC AACCATATAC TGCATAATTT ACTAAGTAGG ATAACTAGTC ATACTGGTAC AAGTAAATTT
GTTATGAAAA ACAATGCTTT CACAGTATTG TGCTGACCTC CGAAATCATT TACTTTCGTG CTAACTTTGT TAAGGCACAA
TGAATATAAT TTAGTAGTCA TGGTGTTATC TTATTGACTT CGAGAAATCA AAAGCCAATT TACTTGAGTG AAAGTGTGAA
CTCAGGAATA ATTGTGTTAT GTAAGCTAGA TACATTTTGT GAGCTACAGC ATGAGAAATC ATTCTCTTAC AAATTTAGTA
TACTGTGAGT GCCATCATGG TAGTTGAAAT TTAAAAGGTT GAATCCCTGA TGGAAGATTA CAAGTTCAGG ATTGGCACAA
TTTGCCCTGA TTTACGGGCT ACAGAATATA TGAGGGATTT AGTAGTTGGA TGTCAACCAT TCGCTTGTTG CTACTACAAA
GCTTCCATGC TATTCCAGAA AATTACTTTC ATACATTAGG TTATCGTGCA TGTACTGACA CTGGTACATT CAGGTTATTG
TGTCACTGGG TAGCGGGCCC TGGGACCAAC TGTTTGGTGG TGGCAATGCA CCAGCCTTTG CAGTGGCTGC TGCTGCATCT
TTTATCGGTG GGCTGGTGGC TATTCTGGGC CTTCCACGAG CCCGCATTGC ATCAAGGAGG AGAGGTCACC GATAAGAATA
TTGCTACATA TAAATTGTCG GCCATTCTTT GCAATTCGAC TCATAAGAGG CACTCGGAAC GCTATGCAGT GCATGGGGGA
ATTGTATATT ATCTCCGAAT CAAGAAGGGG ATAATGCTTG CTTTCTCCAT GAGCTATTTT TGCCTTTTTC ATGCCGGATC
ATCATATGCT GTCGTACATT GGATGATCTT ATGCTGTTGT ACATTGGATG TTGGTCATTT GTAGAGATAC TAGTGAATAA
AAGTTGCAGG AGTTGGTTCA CTCGAGAAAA TTCTGGTCAG TATGTCGTCC ATCTGCTGCA CGACAGCAGT TAGGAGCCGA
ATAGCATGTC CATGGGTTTT CATCAAATGT TGTATCATCA TTTGTTTTTT GATACGTTCA GACGGCTTCA GTGCTGTGTG
AATATATATG TATGGAATAT ATCGAGAAAA TGTTGTTG

Locus: Os12g0641400

Loading...

Locus: Os12g0641400

Loading...