Os12t0641400-02

Locus

Os12g0641400

Description

Sucrose transporter, Tonoplast proton-sucrose symporter, Suc transport across the tonoplast from the vacuole lumen to the cytosol

RAP-DB Gene Symbol Synonym(s)

OsSUT2, SUT2

RAP-DB Gene Name Synonym(s)

SUCROSE TRANSPORTER 2, sucrose transporter 2

CGSNL Gene Symbol

SUT2

CGSNL Gene Name

SUCROSE TRANSPORTER 2

Oryzabase Gene Symbol Synonym(s)

OsSUT2(t), SUT2M, OsSUT2, OsSUT2M, OsSUT5

Oryzabase Gene Name Synonym(s)

sucrose transporter2(t), Sucrose transport protein 2, Sucrose permease 2 ; Sucrose-proton symporter 2, Sucrose transporter 2, Sucrose transporter-2, SUC4-like protein, sucrose transporter 2M

Transcript Evidence

AB091672

HQ540307 (Dongjin)

Protein Evidence

Q0ILJ3

Literature

PMID: 21771914

Note

Manual Curation

May 31, 2017

Gene Ontology (GO)

Biological Process: sucrose transport (GO:0015770)

Biological Process: transmembrane transport (GO:0055085)

Molecular Function: sucrose transmembrane transporter activity (GO:0008515)

Cellular Component: integral component of plasma membrane (GO:0005887)

Cellular Component: integral component of membrane (GO:0016021)

Functional domain (InterPro)

Sucrose/H+ symporter, plant (IPR005989)

Major facilitator superfamily (IPR011701)

Major facilitator superfamily domain (IPR020846)

Experimentally confirmed subcellular location

tonoplast (GO:0009705)

Others

Oryzabase (2208)

Transcript

1856 bp

>Os12t0641400-02 Sucrose transporter, Tonoplast proton-sucrose symporter, Suc transport across the tonoplast from the vacuole lumen to the cytosol
GGCAAGAGACAACCCACTCCTCTTCTGAACTAACCCAAAGATCAGGTCGGAGGCGGAGGC
AAACACGAGAAGAAGATGCCGCGGCGGCCTAGCGGCGGCGGCGGCGGCGCTGGTCCCGCG
GCGGCCGCGGTGCGCAAGGTCCCCCTGCGGAAGCTTCTGCGTGCGGCGTCGGTGGCGTGC
GGCGTGCAGTTCGGGTGGGCGCTGCAGCTCTCCCTGCTGACCCCCTACGTCCAGGAGCTC
GGCATCCCGCACGCCTTCGCCAGCCTCGTCTGGCTCTGCGGCCCCCTCTCCGGCCTCCTC
GTCCAGCCCCTCGTCGGCCACCTCTCCGACCGCATCGCCCCCGCCGCCTCCCCCCTCGGC
CGCCGCCGCCCCTTCATCGCCGCCGGCGCCGCTTCCATCGCTGCCGCAGTTCTCACCGTC
GGATTCTCCGCCGACCTCGGCCGAATCTTCGGCGATTCCATCACCCCGGGCTCCACCCGC
CTCGGCGCCATCATCGTCTACCTCGTCGGCTTCTGGCTCCTCGACGTCGGCAACAACGCT
ACACAGGGACCCTGCAGGGCCTTCCTCGCCGACCTCACCGAGAATGACCCAAGGAGGACT
CGGATAGCTAATGCTTACTTCTCATTGTTCATGGCCCTGGGAAACATACTTGGATATGCC
ACTGGAGCATACAGTGGCTGGTACAAGATATTCCCGTTCACCGTTACTCCATCATGTAGC
ATCAGCTGTGCCAACCTCAAGTCTGCCTTTCTACTTGATATTATCATTTTGGTGGTCACT
ACATGCATCACTGTAGCATCAGTGCAAGAGCCTCAATCCTTTGGAAGTGATGAAGCAGAT
CACCCTAGCACAGAACAGGAAGCTTTCCTCTGGGAACTTTTTGGATCATTCCGGTACTTT
ACATTACCGGTTTGGATGGTTTTGATTGTTACTGCCCTCACATGGATTGGATGGTTTCCA
TTTATCCTCTTTGATACCGATTGGATGGGTCGAGAGATCTATCGTGGAAGTCCAGATGAT
CCAAGTATAACTCAGAGCTATCATGATGGTGTGAGAATGGGTTCTTTTGGTCTGATGCTG
AACTCGGTCCTTCTTGGATTCACTTCTATTGTACTAGAGAAGTTATGTCGGAAGTGGGGA
GCTGGACTGGTGTGGGGTGTCTCCAATATCCTAATGGCATTGTGCTTTGTGGCAATGCTT
GTAATAACATATGTGGCAAAGAATATGGATTATCCACCTAGTGGAGTACCACCAACCGGC
ATTGTCATTGCTTCCCTGGTAGTTTTTACAATTTTAGGAGCGCCCCTGGCGATCACGTAC
AGTATACCATATGCAATGGCTGCTAGTCGGGTTGAAAATCTGGGACTTGGCCAAGGTCTA
GCAATGGGCATTCTTAATTTGGCTATTGTCATACCACAGGTTATTGTGTCACTGGGTAGC
GGGCCCTGGGACCAACTGTTTGGTGGTGGCAATGCACCAGCCTTTGCAGTGGCTGCTGCT
GCATCTTTTATCGGTGGGCTGGTGGCTATTCTGGGCCTTCCACGAGCCCGCATTGCATCA
AGGAGGAGAGGTCACCGATAAGAATATTGCTACATATAAATTGTCGGCCATTCTTTGCAA
TTCGACTCATAAGAGGCACTCGGAACGCTATGCAGTGCATGGGGGAATTGTATATTATCT
CCGAATCAAGAAGGGGATAATGCTTGCTTTCTCCATGAGCTATTTTTGCCTTTTTCATGC
CGGATCATCATATGCTGTCGTACATTGGATGATCTTATGCTGTTGTACATTGGATGTTGG
TCATTTGTAGAGATACTAGTGAATAAAAGTTGCAGGAGTTGGTTCACTCGAGAAAA

CDS

1506 bp

>Os12t0641400-02 Sucrose transporter, Tonoplast proton-sucrose symporter, Suc transport across the tonoplast from the vacuole lumen to the cytosol
ATGCCGCGGCGGCCTAGCGGCGGCGGCGGCGGCGCTGGTCCCGCGGCGGCCGCGGTGCGC
AAGGTCCCCCTGCGGAAGCTTCTGCGTGCGGCGTCGGTGGCGTGCGGCGTGCAGTTCGGG
TGGGCGCTGCAGCTCTCCCTGCTGACCCCCTACGTCCAGGAGCTCGGCATCCCGCACGCC
TTCGCCAGCCTCGTCTGGCTCTGCGGCCCCCTCTCCGGCCTCCTCGTCCAGCCCCTCGTC
GGCCACCTCTCCGACCGCATCGCCCCCGCCGCCTCCCCCCTCGGCCGCCGCCGCCCCTTC
ATCGCCGCCGGCGCCGCTTCCATCGCTGCCGCAGTTCTCACCGTCGGATTCTCCGCCGAC
CTCGGCCGAATCTTCGGCGATTCCATCACCCCGGGCTCCACCCGCCTCGGCGCCATCATC
GTCTACCTCGTCGGCTTCTGGCTCCTCGACGTCGGCAACAACGCTACACAGGGACCCTGC
AGGGCCTTCCTCGCCGACCTCACCGAGAATGACCCAAGGAGGACTCGGATAGCTAATGCT
TACTTCTCATTGTTCATGGCCCTGGGAAACATACTTGGATATGCCACTGGAGCATACAGT
GGCTGGTACAAGATATTCCCGTTCACCGTTACTCCATCATGTAGCATCAGCTGTGCCAAC
CTCAAGTCTGCCTTTCTACTTGATATTATCATTTTGGTGGTCACTACATGCATCACTGTA
GCATCAGTGCAAGAGCCTCAATCCTTTGGAAGTGATGAAGCAGATCACCCTAGCACAGAA
CAGGAAGCTTTCCTCTGGGAACTTTTTGGATCATTCCGGTACTTTACATTACCGGTTTGG
ATGGTTTTGATTGTTACTGCCCTCACATGGATTGGATGGTTTCCATTTATCCTCTTTGAT
ACCGATTGGATGGGTCGAGAGATCTATCGTGGAAGTCCAGATGATCCAAGTATAACTCAG
AGCTATCATGATGGTGTGAGAATGGGTTCTTTTGGTCTGATGCTGAACTCGGTCCTTCTT
GGATTCACTTCTATTGTACTAGAGAAGTTATGTCGGAAGTGGGGAGCTGGACTGGTGTGG
GGTGTCTCCAATATCCTAATGGCATTGTGCTTTGTGGCAATGCTTGTAATAACATATGTG
GCAAAGAATATGGATTATCCACCTAGTGGAGTACCACCAACCGGCATTGTCATTGCTTCC
CTGGTAGTTTTTACAATTTTAGGAGCGCCCCTGGCGATCACGTACAGTATACCATATGCA
ATGGCTGCTAGTCGGGTTGAAAATCTGGGACTTGGCCAAGGTCTAGCAATGGGCATTCTT
AATTTGGCTATTGTCATACCACAGGTTATTGTGTCACTGGGTAGCGGGCCCTGGGACCAA
CTGTTTGGTGGTGGCAATGCACCAGCCTTTGCAGTGGCTGCTGCTGCATCTTTTATCGGT
GGGCTGGTGGCTATTCTGGGCCTTCCACGAGCCCGCATTGCATCAAGGAGGAGAGGTCAC
CGATAA

Protein

502 aa

>Os12t0641400-02 Sucrose transporter, Tonoplast proton-sucrose symporter, Suc transport across the tonoplast from the vacuole lumen to the cytosol
MPRRPSGGGGGAGPAAAAVRKVPLRKLLRAASVACGVQFGWALQLSLLTPYVQELGIPHA
FASLVWLCGPLSGLLVQPLVGHLSDRIAPAASPLGRRRPFIAAGAASIAAAVLTVGFSAD
LGRIFGDSITPGSTRLGAIIVYLVGFWLLDVGNNATQGPCRAFLADLTENDPRRTRIANA
YFSLFMALGNILGYATGAYSGWYKIFPFTVTPSCSISCANLKSAFLLDIIILVVTTCITV
ASVQEPQSFGSDEADHPSTEQEAFLWELFGSFRYFTLPVWMVLIVTALTWIGWFPFILFD
TDWMGREIYRGSPDDPSITQSYHDGVRMGSFGLMLNSVLLGFTSIVLEKLCRKWGAGLVW
GVSNILMALCFVAMLVITYVAKNMDYPPSGVPPTGIVIASLVVFTILGAPLAITYSIPYA
MAASRVENLGLGQGLAMGILNLAIVIPQVIVSLGSGPWDQLFGGGNAPAFAVAAAASFIG
GLVAILGLPRARIASRRRGHR*

5'UTR

chr12:27518031..27518105 (- strand) : 75 bp

CDS

chr12:27517526..27518030 (- strand) : 505 bp

chr12:27515596..27516326 (- strand) : 731 bp

chr12:27515451..27515514 (- strand) : 64 bp

chr12:27515336..27515379 (- strand) : 44 bp

chr12:27514411..27514572 (- strand) : 162 bp

3'UTR

chr12:27514136..27514410 (- strand) : 275 bp

FASTA

>Os12t0641400-02 class=Sequence position=chr12:27514136..27518105 (- strand)
GGCAAGAGAC AACCCACTCC TCTTCTGAAC TAACCCAAAG ATCAGGTCGG AGGCGGAGGC AAACACGAGA AGAAGATGCC
GCGGCGGCCT AGCGGCGGCG GCGGCGGCGC TGGTCCCGCG GCGGCCGCGG TGCGCAAGGT CCCCCTGCGG AAGCTTCTGC
GTGCGGCGTC GGTGGCGTGC GGCGTGCAGT TCGGGTGGGC GCTGCAGCTC TCCCTGCTGA CCCCCTACGT CCAGGAGCTC
GGCATCCCGC ACGCCTTCGC CAGCCTCGTC TGGCTCTGCG GCCCCCTCTC CGGCCTCCTC GTCCAGCCCC TCGTCGGCCA
CCTCTCCGAC CGCATCGCCC CCGCCGCCTC CCCCCTCGGC CGCCGCCGCC CCTTCATCGC CGCCGGCGCC GCTTCCATCG
CTGCCGCAGT TCTCACCGTC GGATTCTCCG CCGACCTCGG CCGAATCTTC GGCGATTCCA TCACCCCGGG CTCCACCCGC
CTCGGCGCCA TCATCGTCTA CCTCGTCGGC TTCTGGCTCC TCGACGTCGG CAACAACGCT ACACAGGGAC CCTGCAGGGC
CTTCCTCGCC GACCTCACCG GTATCTATCT ACCCTACCTA CCATCGATTG CTTGATTGAT TGCTAGCTTG CTTGCTTCCC
AACTTTCGCA TCGAACAGCC AAGAGGAATT GGAATTGGAC CTCGCTTCCG CCACAAGCCA CACCTGCTCA TCTTTTCGAT
TCCGTCCAAT TGCGAAACGT AGGACCAAAC TTCAAAACAA TTTCCTCTTT TTCTTTTTTT TTTCTTATGT GGCTGTATGT
GTGGCTGTGT GTGGACACAA CACAACAGCA GCCTGCCTCT GCGTATCGCT TTCCCCTTTA GCCTGCCTGC CTGAGATTCT
TGCTCCGATG GATGCTGGTC GGCGTAACTC ATTTTGCTTG TCTCCCTAAA AATTATATTA TATATTTCCT CTTCATTTGT
TTATTTATTT TACGGCCATG GTTTTTTGTT TGCCCTGCCA GCTGGCCTAT TATTAGCATC AGGGTTAGGC GAGCTGGACA
ACACGAACCA CAAAACGACA TGACAACTCA TTACACTGCA TATATTTGAA TAATTAGGGT TGGTACAAAT GTCGCACCAA
TTGTTTTTTT TTCATTTCTT CCTTGTAGTT TTTTTTTTCA TTTCTTCCTT GTTTACACGG AGTATTCGAT GGTTGTGGGA
GGGGGAGGTC AAGGGATCGC TTTCTGACTG AGATAGGAAT ATAGAAAGGA AGATATTTGA GTGTTACAGT ACCCCTGTAA
GTTTGGAATC ATAGGAGGAG AAAGAGCATC TTTTGTCAGC AGACAGGGCT ATTGTCTGAG GGGCCCTGGT TAAATAATTG
TAAGGCTGGC AGTGGTTTGT AGCTGTGGTC TTTGTTATGC CTTTGCATTC TATGGGAAAC ACCTGATGCA AACATTACAT
TCAGAAGGCA TGATTGTGCT TTTTGTCATG GAAATGCTGG AGTTCCACGG TAAATTGGTG ATAAAATTGA TATGATTGTA
ATATTACTCC ATGATCTTCT GTTTAGGCAG TCAAATTCAG CTGGCACGAT CTCCATTATC CAATGCATGT GGATATGTGC
ATACAAGAGC TTTTCAGATA TTCTTAACTT GTAGTTGCAC ATGCCTGTCC TCAAATTTTT CCCAGTAATG TTTACACCAA
TAACCCATCT GTGCAATGTA ACGTGTTCGA AAGGCATCGT AATTGCATTA GCATTTTTCC ACACCTCGTA AATGCTCATT
CTGATCCTTT CTATTTCAGA GAATGACCCA AGGAGGACTC GGATAGCTAA TGCTTACTTC TCATTGTTCA TGGCCCTGGG
AAACATACTT GGATATGCCA CTGGAGCATA CAGTGGCTGG TACAAGATAT TCCCGTTCAC CGTTACTCCA TCATGTAGCA
TCAGCTGTGC CAACCTCAAG TCTGCCTTTC TACTTGATAT TATCATTTTG GTGGTCACTA CATGCATCAC TGTAGCATCA
GTGCAAGAGC CTCAATCCTT TGGAAGTGAT GAAGCAGATC ACCCTAGCAC AGAACAGGAA GCTTTCCTCT GGGAACTTTT
TGGATCATTC CGGTACTTTA CATTACCGGT TTGGATGGTT TTGATTGTTA CTGCCCTCAC ATGGATTGGA TGGTTTCCAT
TTATCCTCTT TGATACCGAT TGGATGGGTC GAGAGATCTA TCGTGGAAGT CCAGATGATC CAAGTATAAC TCAGAGCTAT
CATGATGGTG TGAGAATGGG TTCTTTTGGT CTGATGCTGA ACTCGGTCCT TCTTGGATTC ACTTCTATTG TACTAGAGAA
GTTATGTCGG AAGTGGGGAG CTGGACTGGT GTGGGGTGTC TCCAATATCC TAATGGCATT GTGCTTTGTG GCAATGCTTG
TAATAACATA TGTGGCAAAG AATATGGATT ATCCACCTAG TGGAGTACCA CCAACCGGCA TTGTCATTGC TTCCCTGGTA
GTTTTTACAA TTTTAGGAGC GCCCCTGGCG GTGAGTAACA ATTTTTTCCC TCCAGAGTTT CTTCAAGTTC TCACTGGTGT
ATGGTATCCT TATTAATTCT TGTTATTGCA GATCACGTAC AGTATACCAT ATGCAATGGC TGCTAGTCGG GTTGAAAATC
TGGGACTTGG CCAAGGTACT GTTCCTTTTG AGTCAATGCT ATCATTTTGG GTTCCTGTAC TTAGGAAGTC TTTGTTTCAC
ATGCAGGTCT AGCAATGGGC ATTCTTAATT TGGCTATTGT CATACCACAG GTATGTATTT CTTGCCTTTT TTTCTCTTTG
TTTTAGAGTT TGATTCGTTC AAACATATGA CTGTAACACA GTACAATTAT GAATATTGAC ATGATTGCTG TATCCTAAAA
TAACCTGTTG ATGGTGGAAA CTTACTTAAT TCATGGCTCA ACCACAGTTA TCAGACACAA TTTAAGAAAT GGTTTAATGG
TTAATTGTAA GCTATGACCT GCCGTCGACC ATGTCAAAAC AACCATATAC TGCATAATTT ACTAAGTAGG ATAACTAGTC
ATACTGGTAC AAGTAAATTT GTTATGAAAA ACAATGCTTT CACAGTATTG TGCTGACCTC CGAAATCATT TACTTTCGTG
CTAACTTTGT TAAGGCACAA TGAATATAAT TTAGTAGTCA TGGTGTTATC TTATTGACTT CGAGAAATCA AAAGCCAATT
TACTTGAGTG AAAGTGTGAA CTCAGGAATA ATTGTGTTAT GTAAGCTAGA TACATTTTGT GAGCTACAGC ATGAGAAATC
ATTCTCTTAC AAATTTAGTA TACTGTGAGT GCCATCATGG TAGTTGAAAT TTAAAAGGTT GAATCCCTGA TGGAAGATTA
CAAGTTCAGG ATTGGCACAA TTTGCCCTGA TTTACGGGCT ACAGAATATA TGAGGGATTT AGTAGTTGGA TGTCAACCAT
TCGCTTGTTG CTACTACAAA GCTTCCATGC TATTCCAGAA AATTACTTTC ATACATTAGG TTATCGTGCA TGTACTGACA
CTGGTACATT CAGGTTATTG TGTCACTGGG TAGCGGGCCC TGGGACCAAC TGTTTGGTGG TGGCAATGCA CCAGCCTTTG
CAGTGGCTGC TGCTGCATCT TTTATCGGTG GGCTGGTGGC TATTCTGGGC CTTCCACGAG CCCGCATTGC ATCAAGGAGG
AGAGGTCACC GATAAGAATA TTGCTACATA TAAATTGTCG GCCATTCTTT GCAATTCGAC TCATAAGAGG CACTCGGAAC
GCTATGCAGT GCATGGGGGA ATTGTATATT ATCTCCGAAT CAAGAAGGGG ATAATGCTTG CTTTCTCCAT GAGCTATTTT
TGCCTTTTTC ATGCCGGATC ATCATATGCT GTCGTACATT GGATGATCTT ATGCTGTTGT ACATTGGATG TTGGTCATTT
GTAGAGATAC TAGTGAATAA AAGTTGCAGG AGTTGGTTCA CTCGAGAAAA 

Locus: Os12g0641400

Loading...

Locus: Os12g0641400

Loading...